Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q06596

Protein Details
Accession Q06596   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAKPRGRKGGRKPSLTPPKNKRAAQBasic
NLS Segment(s)
PositionSequence
3-38KPRGRKGGRKPSLTPPKNKRAAQLRASQNAFRKRKL
Subcellular Location(s) nucl 19.5, cyto_nucl 13.166, mito_nucl 12.999, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
IPR023167  Yap1_redox_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0090575  C:RNA polymerase II transcription regulator complex  
GO:0003677  F:DNA binding  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0000976  F:transcription cis-regulatory region binding  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0046685  P:response to arsenic-containing substance  
KEGG sce:YPR199C  -  
Amino Acid Sequences MAKPRGRKGGRKPSLTPPKNKRAAQLRASQNAFRKRKLERLEELEKKEAQLTVTNDQIHILKKENELLHFMLRSLLTERNMPSDERNISKACCEEKPPTCNTLDGSVVLSSTYNSLEIQQCYVFFKQLLSVCVGKNCTVPSPLNSFDRSFYPIGCTNLSNDIPGYSFLNDAMSEIHTFGDFNGELDSTFLEFSGTEIKEPNNFITENTNAIETAAASMVIRQGFHPRQYYTVDAFGGDVLLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.8
4 0.79
5 0.81
6 0.82
7 0.8
8 0.78
9 0.76
10 0.77
11 0.74
12 0.73
13 0.71
14 0.7
15 0.72
16 0.68
17 0.67
18 0.68
19 0.66
20 0.62
21 0.59
22 0.57
23 0.62
24 0.65
25 0.64
26 0.62
27 0.65
28 0.7
29 0.72
30 0.71
31 0.67
32 0.6
33 0.52
34 0.46
35 0.39
36 0.3
37 0.28
38 0.27
39 0.26
40 0.29
41 0.29
42 0.27
43 0.27
44 0.28
45 0.24
46 0.22
47 0.23
48 0.22
49 0.23
50 0.3
51 0.31
52 0.3
53 0.3
54 0.3
55 0.29
56 0.25
57 0.24
58 0.19
59 0.17
60 0.17
61 0.16
62 0.17
63 0.16
64 0.19
65 0.2
66 0.22
67 0.23
68 0.23
69 0.23
70 0.25
71 0.28
72 0.27
73 0.29
74 0.26
75 0.26
76 0.27
77 0.28
78 0.25
79 0.24
80 0.26
81 0.3
82 0.35
83 0.39
84 0.4
85 0.39
86 0.37
87 0.36
88 0.32
89 0.27
90 0.22
91 0.17
92 0.15
93 0.12
94 0.11
95 0.1
96 0.09
97 0.06
98 0.07
99 0.06
100 0.05
101 0.06
102 0.08
103 0.11
104 0.11
105 0.13
106 0.12
107 0.12
108 0.15
109 0.15
110 0.14
111 0.11
112 0.1
113 0.13
114 0.14
115 0.15
116 0.15
117 0.16
118 0.15
119 0.17
120 0.18
121 0.15
122 0.15
123 0.14
124 0.13
125 0.14
126 0.14
127 0.15
128 0.18
129 0.2
130 0.21
131 0.22
132 0.21
133 0.2
134 0.2
135 0.21
136 0.17
137 0.15
138 0.16
139 0.17
140 0.18
141 0.18
142 0.17
143 0.15
144 0.19
145 0.18
146 0.15
147 0.12
148 0.11
149 0.1
150 0.11
151 0.11
152 0.07
153 0.07
154 0.07
155 0.08
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.07
163 0.06
164 0.06
165 0.06
166 0.08
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.08
173 0.08
174 0.05
175 0.05
176 0.05
177 0.05
178 0.04
179 0.05
180 0.11
181 0.11
182 0.11
183 0.13
184 0.14
185 0.16
186 0.18
187 0.18
188 0.14
189 0.14
190 0.15
191 0.18
192 0.18
193 0.17
194 0.17
195 0.16
196 0.13
197 0.13
198 0.12
199 0.08
200 0.08
201 0.06
202 0.05
203 0.05
204 0.05
205 0.07
206 0.08
207 0.08
208 0.08
209 0.17
210 0.21
211 0.25
212 0.29
213 0.28
214 0.31
215 0.34
216 0.37
217 0.31
218 0.29
219 0.25
220 0.21
221 0.2
222 0.17
223 0.14
224 0.09
225 0.07
226 0.04
227 0.04
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.04
234 0.05
235 0.06
236 0.07
237 0.16
238 0.18
239 0.25
240 0.31
241 0.35
242 0.37
243 0.4
244 0.43
245 0.35
246 0.35
247 0.3
248 0.24
249 0.21
250 0.19
251 0.17
252 0.14
253 0.12
254 0.11
255 0.11
256 0.12
257 0.15
258 0.21
259 0.23
260 0.27
261 0.3
262 0.32
263 0.33
264 0.32
265 0.3
266 0.24
267 0.24
268 0.23
269 0.23
270 0.2
271 0.22
272 0.22
273 0.21
274 0.26