FuNGI

P19880

Protein Details

Accession

P19880

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
43-100	GEDSEQPKKKGSKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLE	Hydrophilic

NLS Segment(s)

Position	Sequence
50-92	KKKGSKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKEL

Subcellular Location(s)

nucl 24.5, cyto_nucl 16

Family & Domain DBs

InterPro	View protein in InterPro IPR004827 bZIP IPR046347 bZIP_sf IPR013910 TF_PAP1 IPR023167 Yap1_redox_dom_sf
Gene Ontology	GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0090575 C:RNA polymerase II transcription regulator complex GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0003700 F:DNA-binding transcription factor activity GO:0060090 F:molecular adaptor activity GO:0000976 F:transcription cis-regulatory region binding GO:1900101 P:regulation of endoplasmic reticulum unfolded protein response GO:0006357 P:regulation of transcription by RNA polymerase II GO:0046686 P:response to cadmium ion GO:0009408 P:response to heat GO:0000304 P:response to singlet oxygen
KEGG	sce:YML007W -
Pfam	View protein in Pfam PF00170 bZIP_1 PF08601 PAP1
PROSITE	View protein in PROSITE PS50217 BZIP PS00036 BZIP_BASIC
CDD	cd14688 bZIP_YAP

Amino Acid Sequences

MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPKKKGSKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNFTFQYPLDNDNDNDNSKNVGKQLPSPNDPSHSAPMPINQTQKKLSDATDSSSATLDSLSNSNDVLNNTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFASSSILSSNSPALTNTWESHSNITDNTPANVIATDATKYENSFSGFGRLGFDMSANHYVVNDNSTGSTDSTGSTGNKNKKNNNNSDDVLPFISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEDDDDDKKAANMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQNADKINNGNDNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.24
3	0.23
4	0.2
5	0.15
6	0.12
7	0.1
8	0.09
9	0.16
10	0.17
11	0.19
12	0.23
13	0.24
14	0.27
15	0.28
16	0.31
17	0.33
18	0.43
19	0.51
20	0.51
21	0.5
22	0.48
23	0.48
24	0.48
25	0.46
26	0.44
27	0.4
28	0.4
29	0.42
30	0.45
31	0.51
32	0.51
33	0.53
34	0.52
35	0.47
36	0.51
37	0.53
38	0.55
39	0.58
40	0.65
41	0.67
42	0.71
43	0.81
44	0.85
45	0.83
46	0.84
47	0.83
48	0.82
49	0.79
50	0.77
51	0.77
52	0.75
53	0.74
54	0.72
55	0.69
56	0.69
57	0.71
58	0.72
59	0.7
60	0.71
61	0.77
62	0.82
63	0.8
64	0.74
65	0.7
66	0.7
67	0.69
68	0.68
69	0.69
70	0.66
71	0.71
72	0.79
73	0.78
74	0.76
75	0.8
76	0.82
77	0.82
78	0.87
79	0.86
80	0.82
81	0.8
82	0.74
83	0.65
84	0.57
85	0.5
86	0.44
87	0.43
88	0.41
89	0.37
90	0.38
91	0.36
92	0.35
93	0.31
94	0.25
95	0.17
96	0.11
97	0.16
98	0.13
99	0.13
100	0.14
101	0.13
102	0.13
103	0.14
104	0.18
105	0.13
106	0.14
107	0.2
108	0.2
109	0.24
110	0.25
111	0.26
112	0.28
113	0.34
114	0.42
115	0.43
116	0.5
117	0.56
118	0.65
119	0.7
120	0.68
121	0.65
122	0.57
123	0.51
124	0.46
125	0.42
126	0.33
127	0.3
128	0.35
129	0.34
130	0.32
131	0.34
132	0.34
133	0.38
134	0.43
135	0.42
136	0.35
137	0.37
138	0.47
139	0.51
140	0.57
141	0.53
142	0.49
143	0.48
144	0.5
145	0.53
146	0.43
147	0.38
148	0.31
149	0.27
150	0.28
151	0.26
152	0.25
153	0.2
154	0.21
155	0.18
156	0.17
157	0.18
158	0.23
159	0.24
160	0.25
161	0.27
162	0.26
163	0.28
164	0.33
165	0.36
166	0.29
167	0.3
168	0.33
169	0.29
170	0.35
171	0.35
172	0.32
173	0.29
174	0.3
175	0.27
176	0.26
177	0.28
178	0.23
179	0.23
180	0.2
181	0.2
182	0.19
183	0.2
184	0.18
185	0.19
186	0.19
187	0.26
188	0.35
189	0.38
190	0.4
191	0.44
192	0.43
193	0.43
194	0.45
195	0.4
196	0.35
197	0.3
198	0.28
199	0.23
200	0.25
201	0.28
202	0.29
203	0.33
204	0.32
205	0.34
206	0.35
207	0.36
208	0.35
209	0.31
210	0.28
211	0.27
212	0.25
213	0.25
214	0.27
215	0.25
216	0.23
217	0.21
218	0.2
219	0.14
220	0.13
221	0.1
222	0.07
223	0.08
224	0.08
225	0.08
226	0.08
227	0.08
228	0.1
229	0.1
230	0.11
231	0.13
232	0.13
233	0.14
234	0.14
235	0.14
236	0.15
237	0.16
238	0.14
239	0.13
240	0.15
241	0.14
242	0.14
243	0.14
244	0.11
245	0.1
246	0.11
247	0.1
248	0.08
249	0.08
250	0.08
251	0.08
252	0.08
253	0.08
254	0.09
255	0.1
256	0.11
257	0.12
258	0.13
259	0.14
260	0.16
261	0.16
262	0.15
263	0.14
264	0.13
265	0.18
266	0.19
267	0.23
268	0.23
269	0.25
270	0.27
271	0.28
272	0.27
273	0.22
274	0.21
275	0.17
276	0.15
277	0.13
278	0.1
279	0.11
280	0.11
281	0.11
282	0.1
283	0.1
284	0.09
285	0.09
286	0.11
287	0.1
288	0.1
289	0.09
290	0.09
291	0.09
292	0.1
293	0.13
294	0.14
295	0.15
296	0.19
297	0.24
298	0.26
299	0.28
300	0.3
301	0.33
302	0.37
303	0.39
304	0.44
305	0.43
306	0.43
307	0.43
308	0.48
309	0.46
310	0.43
311	0.43
312	0.35
313	0.32
314	0.3
315	0.27
316	0.19
317	0.15
318	0.12
319	0.07
320	0.07
321	0.06
322	0.06
323	0.06
324	0.07
325	0.07
326	0.07
327	0.07
328	0.07
329	0.07
330	0.09
331	0.11
332	0.11
333	0.12
334	0.14
335	0.15
336	0.16
337	0.16
338	0.15
339	0.13
340	0.14
341	0.15
342	0.14
343	0.13
344	0.12
345	0.11
346	0.11
347	0.1
348	0.09
349	0.06
350	0.06
351	0.06
352	0.06
353	0.07
354	0.07
355	0.08
356	0.09
357	0.1
358	0.11
359	0.12
360	0.12
361	0.14
362	0.14
363	0.14
364	0.14
365	0.13
366	0.11
367	0.1
368	0.1
369	0.07
370	0.1
371	0.12
372	0.11
373	0.1
374	0.1
375	0.11
376	0.11
377	0.12
378	0.09
379	0.07
380	0.07
381	0.08
382	0.09
383	0.08
384	0.09
385	0.08
386	0.08
387	0.08
388	0.1
389	0.1
390	0.14
391	0.21
392	0.28
393	0.34
394	0.41
395	0.48
396	0.56
397	0.64
398	0.69
399	0.66
400	0.64
401	0.59
402	0.56
403	0.48
404	0.4
405	0.3
406	0.21
407	0.17
408	0.12
409	0.11
410	0.07
411	0.08
412	0.1
413	0.1
414	0.11
415	0.11
416	0.11
417	0.12
418	0.14
419	0.15
420	0.11
421	0.11
422	0.11
423	0.1
424	0.1
425	0.09
426	0.1
427	0.09
428	0.08
429	0.09
430	0.11
431	0.12
432	0.11
433	0.11
434	0.1
435	0.09
436	0.12
437	0.11
438	0.1
439	0.1
440	0.1
441	0.12
442	0.13
443	0.14
444	0.14
445	0.17
446	0.2
447	0.2
448	0.2
449	0.17
450	0.21
451	0.21
452	0.18
453	0.2
454	0.17
455	0.17
456	0.16
457	0.18
458	0.13
459	0.12
460	0.15
461	0.1
462	0.12
463	0.14
464	0.16
465	0.16
466	0.17
467	0.18
468	0.14
469	0.14
470	0.18
471	0.16
472	0.18
473	0.22
474	0.23
475	0.28
476	0.35
477	0.38
478	0.34
479	0.35
480	0.32
481	0.27
482	0.29
483	0.28
484	0.23
485	0.24
486	0.24
487	0.24
488	0.24
489	0.25
490	0.24
491	0.23
492	0.25
493	0.21
494	0.26
495	0.26
496	0.24
497	0.23
498	0.2
499	0.19
500	0.14
501	0.14
502	0.11
503	0.1
504	0.1
505	0.11
506	0.12
507	0.1
508	0.1
509	0.1
510	0.1
511	0.1
512	0.11
513	0.12
514	0.14
515	0.16
516	0.16
517	0.17
518	0.16
519	0.16
520	0.15
521	0.15
522	0.14
523	0.14
524	0.15
525	0.19
526	0.2
527	0.22
528	0.23
529	0.28
530	0.28
531	0.3
532	0.33
533	0.29
534	0.28
535	0.27
536	0.28
537	0.25
538	0.28
539	0.3
540	0.29
541	0.3
542	0.31
543	0.32
544	0.28
545	0.26
546	0.28
547	0.25
548	0.27
549	0.25
550	0.23
551	0.22
552	0.26
553	0.26
554	0.23
555	0.24
556	0.26
557	0.32
558	0.33
559	0.32
560	0.32
561	0.35
562	0.35
563	0.37
564	0.33
565	0.31
566	0.32
567	0.35
568	0.32
569	0.31
570	0.28
571	0.22
572	0.22
573	0.19
574	0.18
575	0.15
576	0.13
577	0.12
578	0.17
579	0.18
580	0.2
581	0.24
582	0.25
583	0.27
584	0.27
585	0.29
586	0.29
587	0.32
588	0.32
589	0.3
590	0.32
591	0.36
592	0.45
593	0.44
594	0.45
595	0.43
596	0.44
597	0.44
598	0.43
599	0.42
600	0.35
601	0.37
602	0.31
603	0.29
604	0.26
605	0.24
606	0.2
607	0.14
608	0.11
609	0.1
610	0.15
611	0.14
612	0.16
613	0.2
614	0.25
615	0.31
616	0.33
617	0.34
618	0.33
619	0.38
620	0.39
621	0.38
622	0.34
623	0.33
624	0.31
625	0.28
626	0.23
627	0.18
628	0.15
629	0.14
630	0.14

P19880

3D AlphaFold-predicted Structure Viewer