Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53287

Protein Details
Accession P53287   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-107ELALLHNKRKRRKTLPLALFYSHHydrophilic
NLS Segment(s)
PositionSequence
93-96RKRR
Subcellular Location(s) nucl 19, mito_nucl 13.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Amino Acid Sequences MKWKVLQLKTQEIKVNNLAKSSLHQPGSLVLRNRIRNNQTISNHQKVYITNLHKDKLKLNNLLRLMKSTNRHMPFRNLVLATGQELALLHNKRKRRKTLPLALFYSHLILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.44
4 0.41
5 0.36
6 0.3
7 0.32
8 0.31
9 0.3
10 0.25
11 0.24
12 0.23
13 0.27
14 0.31
15 0.32
16 0.3
17 0.29
18 0.35
19 0.41
20 0.45
21 0.48
22 0.47
23 0.48
24 0.51
25 0.53
26 0.49
27 0.53
28 0.56
29 0.53
30 0.5
31 0.45
32 0.41
33 0.33
34 0.35
35 0.33
36 0.29
37 0.3
38 0.32
39 0.33
40 0.34
41 0.35
42 0.34
43 0.35
44 0.37
45 0.39
46 0.39
47 0.43
48 0.44
49 0.46
50 0.41
51 0.36
52 0.33
53 0.3
54 0.31
55 0.31
56 0.37
57 0.37
58 0.41
59 0.41
60 0.45
61 0.45
62 0.44
63 0.42
64 0.33
65 0.3
66 0.27
67 0.25
68 0.2
69 0.16
70 0.13
71 0.09
72 0.08
73 0.09
74 0.15
75 0.17
76 0.22
77 0.27
78 0.35
79 0.45
80 0.54
81 0.63
82 0.65
83 0.74
84 0.79
85 0.84
86 0.86
87 0.85
88 0.8
89 0.72
90 0.64
91 0.54