FuNGI

Q03063

Protein Details

Accession

Q03063

Localization Confidence

Medium

Confidence Score

14.2

NoLS Segment(s)

Position	Sequence	Protein Nature
76-106	SETATAKKRKAQPLKNPKKSLKRGRVPAPLN	Hydrophilic

NLS Segment(s)

Position	Sequence
82-100	KKRKAQPLKNPKKSLKRGR

Subcellular Location(s)

nucl 24, cyto_nucl 14.5

Family & Domain DBs

Gene Ontology

GO:0005634  C:nucleus
GO:1990526  C:Ste12p-Dig1p-Dig2p complex
GO:1990527  C:Tec1p-Ste12p-Dig1p complex
GO:0003714  F:transcription corepressor activity
GO:2000218  P:negative regulation of invasive growth in response to glucose limitation
GO:0045894  P:negative regulation of mating-type specific transcription, DNA-templated
GO:2000221  P:negative regulation of pseudohyphal growth
GO:0000122  P:negative regulation of transcription by RNA polymerase II
GO:0010570  P:regulation of filamentous growth

KEGG

sce:YPL049C -

Amino Acid Sequences

MAVSARLRTTAEDTSIAKSTQDPIGDTEISVANAKGSSDSNIKNSPGGNSVGQESELEHVPEEDDSGDKEADHEDSETATAKKRKAQPLKNPKKSLKRGRVPAPLNLSDSNTNTHGGNIKDGNLASSNSAHFPPVANQNVKSAPAQVTQHSKFQPRVQYLGKASSRQSIQVNNSSNSYGKPHMPSAGIMSAMNPYMPMNRYIMSPYYNPYGIPPPHMLNKPIMTPYVSYPYPMGPRTSIPYAMQGGNARPYEENEYSASNYRNKRVNDSYDSPLSGTASTGKTRRSEEGSRNSSVGSSANAGPTQQRADLRPADMIPAEEYHFERDALLSANTKARSASTSTSTSTSTNRDRSSWHEAEPNKDEEEGTDLAIEDGAVPTPTFTTFQRTSQPQQQSPSLLQGEIRLSSHIFAFEFPLSSSNVDKKMFMSICNKVWNESKELTKKSSSHHRTGK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.31
3	0.29
4	0.24
5	0.23
6	0.23
7	0.23
8	0.23
9	0.21
10	0.21
11	0.26
12	0.26
13	0.24
14	0.23
15	0.2
16	0.2
17	0.19
18	0.16
19	0.12
20	0.12
21	0.12
22	0.12
23	0.12
24	0.15
25	0.2
26	0.23
27	0.28
28	0.31
29	0.32
30	0.33
31	0.33
32	0.32
33	0.28
34	0.29
35	0.24
36	0.22
37	0.23
38	0.21
39	0.2
40	0.18
41	0.15
42	0.15
43	0.15
44	0.14
45	0.12
46	0.12
47	0.12
48	0.11
49	0.11
50	0.09
51	0.08
52	0.09
53	0.12
54	0.11
55	0.1
56	0.11
57	0.12
58	0.13
59	0.13
60	0.13
61	0.1
62	0.11
63	0.12
64	0.14
65	0.14
66	0.2
67	0.24
68	0.26
69	0.34
70	0.42
71	0.52
72	0.6
73	0.69
74	0.73
75	0.79
76	0.88
77	0.9
78	0.91
79	0.9
80	0.9
81	0.9
82	0.9
83	0.9
84	0.88
85	0.86
86	0.86
87	0.87
88	0.79
89	0.75
90	0.71
91	0.63
92	0.57
93	0.49
94	0.43
95	0.36
96	0.34
97	0.3
98	0.24
99	0.22
100	0.19
101	0.19
102	0.2
103	0.18
104	0.21
105	0.19
106	0.19
107	0.2
108	0.19
109	0.19
110	0.16
111	0.16
112	0.14
113	0.14
114	0.14
115	0.13
116	0.14
117	0.13
118	0.12
119	0.12
120	0.14
121	0.2
122	0.26
123	0.26
124	0.26
125	0.3
126	0.31
127	0.31
128	0.28
129	0.24
130	0.2
131	0.21
132	0.22
133	0.22
134	0.29
135	0.3
136	0.35
137	0.36
138	0.38
139	0.38
140	0.42
141	0.46
142	0.4
143	0.44
144	0.4
145	0.43
146	0.41
147	0.45
148	0.42
149	0.36
150	0.35
151	0.34
152	0.32
153	0.3
154	0.3
155	0.27
156	0.29
157	0.34
158	0.36
159	0.32
160	0.33
161	0.31
162	0.29
163	0.24
164	0.24
165	0.19
166	0.18
167	0.19
168	0.19
169	0.2
170	0.2
171	0.19
172	0.18
173	0.17
174	0.14
175	0.12
176	0.11
177	0.1
178	0.09
179	0.09
180	0.06
181	0.06
182	0.07
183	0.08
184	0.09
185	0.1
186	0.1
187	0.11
188	0.12
189	0.13
190	0.13
191	0.13
192	0.14
193	0.15
194	0.15
195	0.14
196	0.14
197	0.2
198	0.18
199	0.2
200	0.2
201	0.19
202	0.25
203	0.26
204	0.25
205	0.22
206	0.22
207	0.21
208	0.2
209	0.18
210	0.14
211	0.14
212	0.14
213	0.16
214	0.14
215	0.14
216	0.13
217	0.15
218	0.17
219	0.17
220	0.17
221	0.13
222	0.14
223	0.18
224	0.18
225	0.18
226	0.15
227	0.17
228	0.18
229	0.17
230	0.17
231	0.15
232	0.14
233	0.18
234	0.17
235	0.16
236	0.14
237	0.15
238	0.2
239	0.19
240	0.2
241	0.16
242	0.17
243	0.18
244	0.21
245	0.21
246	0.22
247	0.24
248	0.27
249	0.33
250	0.33
251	0.38
252	0.41
253	0.44
254	0.45
255	0.47
256	0.46
257	0.41
258	0.4
259	0.34
260	0.29
261	0.23
262	0.16
263	0.12
264	0.11
265	0.11
266	0.14
267	0.16
268	0.18
269	0.2
270	0.23
271	0.26
272	0.29
273	0.34
274	0.4
275	0.47
276	0.49
277	0.48
278	0.46
279	0.43
280	0.36
281	0.3
282	0.22
283	0.13
284	0.11
285	0.1
286	0.11
287	0.11
288	0.12
289	0.12
290	0.13
291	0.14
292	0.14
293	0.16
294	0.16
295	0.22
296	0.24
297	0.24
298	0.24
299	0.23
300	0.22
301	0.2
302	0.18
303	0.14
304	0.13
305	0.12
306	0.12
307	0.13
308	0.14
309	0.15
310	0.14
311	0.13
312	0.12
313	0.12
314	0.12
315	0.13
316	0.11
317	0.12
318	0.17
319	0.17
320	0.17
321	0.17
322	0.16
323	0.17
324	0.19
325	0.2
326	0.2
327	0.22
328	0.23
329	0.25
330	0.25
331	0.25
332	0.24
333	0.28
334	0.31
335	0.35
336	0.35
337	0.34
338	0.35
339	0.41
340	0.47
341	0.43
342	0.39
343	0.4
344	0.41
345	0.47
346	0.49
347	0.45
348	0.36
349	0.34
350	0.31
351	0.24
352	0.26
353	0.19
354	0.15
355	0.12
356	0.11
357	0.11
358	0.11
359	0.1
360	0.05
361	0.05
362	0.06
363	0.06
364	0.05
365	0.06
366	0.07
367	0.08
368	0.1
369	0.1
370	0.18
371	0.2
372	0.23
373	0.31
374	0.36
375	0.42
376	0.49
377	0.58
378	0.54
379	0.57
380	0.58
381	0.55
382	0.5
383	0.51
384	0.43
385	0.35
386	0.3
387	0.28
388	0.27
389	0.24
390	0.23
391	0.17
392	0.16
393	0.17
394	0.17
395	0.15
396	0.13
397	0.12
398	0.15
399	0.14
400	0.15
401	0.14
402	0.15
403	0.15
404	0.17
405	0.2
406	0.22
407	0.27
408	0.27
409	0.27
410	0.26
411	0.34
412	0.33
413	0.34
414	0.36
415	0.37
416	0.41
417	0.48
418	0.48
419	0.43
420	0.5
421	0.48
422	0.47
423	0.46
424	0.5
425	0.51
426	0.55
427	0.56
428	0.56
429	0.56
430	0.57
431	0.64
432	0.62

Q03063

3D AlphaFold-predicted Structure Viewer