Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40083

Protein Details
Accession P40083    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
106-132TIQGVTSKKSSKKKKNKIKCSFCHEAGHydrophilic
NLS Segment(s)
PositionSequence
113-122KKSSKKKKNK
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG sce:YER137C  -  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MCESSNKTENDIVRLSQAMDVLAKLIISKQKDGSQLQVEYEHKLKELEKFINLLLGLHESTVGSMMNTSVLDMVLRNGIEIMEKDDQKYALIPIKAKEEADKTTSTIQGVTSKKSSKKKKNKIKCSFCHEAGHTRAHCGARLTVIPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.2
4 0.18
5 0.14
6 0.12
7 0.11
8 0.1
9 0.09
10 0.08
11 0.06
12 0.09
13 0.14
14 0.16
15 0.18
16 0.21
17 0.25
18 0.31
19 0.32
20 0.34
21 0.35
22 0.34
23 0.32
24 0.34
25 0.31
26 0.29
27 0.3
28 0.25
29 0.2
30 0.21
31 0.21
32 0.21
33 0.25
34 0.24
35 0.23
36 0.23
37 0.23
38 0.23
39 0.22
40 0.16
41 0.11
42 0.1
43 0.09
44 0.07
45 0.08
46 0.05
47 0.05
48 0.06
49 0.05
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.09
69 0.11
70 0.12
71 0.12
72 0.13
73 0.13
74 0.13
75 0.14
76 0.12
77 0.13
78 0.15
79 0.16
80 0.16
81 0.2
82 0.21
83 0.21
84 0.22
85 0.2
86 0.21
87 0.22
88 0.22
89 0.2
90 0.22
91 0.22
92 0.2
93 0.17
94 0.16
95 0.2
96 0.21
97 0.23
98 0.25
99 0.3
100 0.38
101 0.47
102 0.57
103 0.61
104 0.71
105 0.78
106 0.85
107 0.9
108 0.93
109 0.95
110 0.95
111 0.92
112 0.9
113 0.87
114 0.8
115 0.76
116 0.68
117 0.65
118 0.58
119 0.58
120 0.5
121 0.45
122 0.46
123 0.41
124 0.39
125 0.34
126 0.32
127 0.27
128 0.31