Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P34247

Protein Details
Accession P34247   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
185-212MPKESLDKKKLKKFKQVKQHLQRETQLKHydrophilic
NLS Segment(s)
PositionSequence
193-197KKLKK
226-250KKGSKKKIVDSSGKISFKWKKQRKR
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0032040  C:small-subunit processome  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0030490  P:maturation of SSU-rRNA  
GO:0006364  P:rRNA processing  
GO:0006412  P:translation  
KEGG sce:YKL099C  -  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MAKLVHDVQKKQHRERSQLTSRSRYGFLEKHKDYVKRAQDFHRKQSTLKVLREKAKERNPDEYYHAMHSRKTDAKGLLISSRHGDEEDESLSMDQVKLLKTQDSNYVRTLRQIELKKLEKGAKQLMFKSSGNHTIFVDSREKMNEFTPEKFFNTTSEMVNRSENRLTKDQLAQDISNNRNASSIMPKESLDKKKLKKFKQVKQHLQRETQLKQVQQRMDAQRELLKKGSKKKIVDSSGKISFKWKKQRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.79
4 0.79
5 0.79
6 0.78
7 0.77
8 0.73
9 0.68
10 0.62
11 0.55
12 0.52
13 0.49
14 0.5
15 0.53
16 0.5
17 0.52
18 0.57
19 0.58
20 0.56
21 0.59
22 0.6
23 0.56
24 0.59
25 0.63
26 0.68
27 0.7
28 0.75
29 0.75
30 0.67
31 0.61
32 0.66
33 0.66
34 0.63
35 0.64
36 0.64
37 0.61
38 0.68
39 0.74
40 0.71
41 0.7
42 0.7
43 0.72
44 0.67
45 0.69
46 0.64
47 0.59
48 0.58
49 0.53
50 0.46
51 0.42
52 0.43
53 0.35
54 0.34
55 0.33
56 0.34
57 0.35
58 0.34
59 0.35
60 0.3
61 0.32
62 0.31
63 0.31
64 0.28
65 0.24
66 0.23
67 0.19
68 0.19
69 0.17
70 0.15
71 0.14
72 0.11
73 0.12
74 0.12
75 0.1
76 0.1
77 0.09
78 0.09
79 0.09
80 0.07
81 0.06
82 0.07
83 0.08
84 0.09
85 0.1
86 0.12
87 0.13
88 0.14
89 0.23
90 0.25
91 0.27
92 0.28
93 0.31
94 0.29
95 0.31
96 0.32
97 0.25
98 0.29
99 0.29
100 0.3
101 0.34
102 0.37
103 0.36
104 0.37
105 0.39
106 0.34
107 0.35
108 0.38
109 0.35
110 0.34
111 0.34
112 0.32
113 0.32
114 0.3
115 0.28
116 0.24
117 0.27
118 0.26
119 0.25
120 0.23
121 0.21
122 0.22
123 0.22
124 0.23
125 0.15
126 0.15
127 0.16
128 0.16
129 0.15
130 0.16
131 0.21
132 0.2
133 0.22
134 0.25
135 0.25
136 0.26
137 0.27
138 0.26
139 0.2
140 0.22
141 0.21
142 0.19
143 0.2
144 0.2
145 0.2
146 0.24
147 0.23
148 0.23
149 0.26
150 0.28
151 0.3
152 0.32
153 0.33
154 0.32
155 0.35
156 0.34
157 0.33
158 0.34
159 0.29
160 0.29
161 0.34
162 0.32
163 0.34
164 0.32
165 0.28
166 0.25
167 0.25
168 0.23
169 0.23
170 0.24
171 0.22
172 0.23
173 0.23
174 0.28
175 0.37
176 0.42
177 0.42
178 0.48
179 0.53
180 0.62
181 0.72
182 0.74
183 0.76
184 0.79
185 0.81
186 0.83
187 0.85
188 0.87
189 0.88
190 0.9
191 0.86
192 0.82
193 0.8
194 0.77
195 0.68
196 0.66
197 0.6
198 0.55
199 0.56
200 0.57
201 0.53
202 0.49
203 0.55
204 0.53
205 0.54
206 0.51
207 0.46
208 0.45
209 0.46
210 0.45
211 0.43
212 0.42
213 0.44
214 0.53
215 0.6
216 0.62
217 0.63
218 0.69
219 0.73
220 0.74
221 0.76
222 0.72
223 0.7
224 0.71
225 0.68
226 0.59
227 0.58
228 0.59
229 0.59
230 0.64