Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P15315

Protein Details
Accession P15315    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
84-109EGEPCKCHTKRKSSRKSKGGSCHRRABasic
NLS Segment(s)
PositionSequence
98-99RK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0006878  P:intracellular copper ion homeostasis  
GO:0006879  P:intracellular iron ion homeostasis  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006357  P:regulation of transcription by RNA polymerase II  
GO:0046688  P:response to copper ion  
KEGG sce:YGL166W  -  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS01119  COPPER_FIST_1  
PS50073  COPPER_FIST_2  
Amino Acid Sequences MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGRPSTTCGHCKELRRTKNFNPSGGCMCASARRPAVGSKEDETRCRCDEGEPCKCHTKRKSSRKSKGGSCHRRANDEAAHVNGLGIADLDVLLGLNGRSSDVDMTTTLPSLKPPLQNGEIKADSIDNLDLASLDPLEQSPSISMEPVSINETGSAYTTTNTALNDIDIPFSINELNELYKQVSSHNSHSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.36
4 0.4
5 0.46
6 0.49
7 0.51
8 0.5
9 0.45
10 0.46
11 0.45
12 0.41
13 0.35
14 0.29
15 0.3
16 0.3
17 0.3
18 0.28
19 0.35
20 0.38
21 0.43
22 0.48
23 0.48
24 0.54
25 0.53
26 0.55
27 0.57
28 0.6
29 0.63
30 0.61
31 0.63
32 0.59
33 0.62
34 0.67
35 0.68
36 0.7
37 0.69
38 0.73
39 0.74
40 0.8
41 0.76
42 0.7
43 0.63
44 0.58
45 0.53
46 0.47
47 0.39
48 0.29
49 0.25
50 0.26
51 0.24
52 0.25
53 0.21
54 0.2
55 0.21
56 0.23
57 0.27
58 0.25
59 0.26
60 0.24
61 0.32
62 0.33
63 0.37
64 0.37
65 0.38
66 0.36
67 0.34
68 0.32
69 0.28
70 0.33
71 0.37
72 0.43
73 0.41
74 0.43
75 0.5
76 0.51
77 0.56
78 0.56
79 0.58
80 0.59
81 0.68
82 0.76
83 0.78
84 0.86
85 0.86
86 0.85
87 0.82
88 0.81
89 0.81
90 0.8
91 0.75
92 0.75
93 0.67
94 0.65
95 0.58
96 0.53
97 0.44
98 0.36
99 0.31
100 0.23
101 0.21
102 0.17
103 0.16
104 0.11
105 0.09
106 0.05
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.05
123 0.05
124 0.06
125 0.06
126 0.08
127 0.08
128 0.09
129 0.09
130 0.08
131 0.09
132 0.12
133 0.15
134 0.16
135 0.18
136 0.23
137 0.27
138 0.3
139 0.31
140 0.34
141 0.3
142 0.28
143 0.26
144 0.21
145 0.17
146 0.15
147 0.14
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.04
155 0.04
156 0.05
157 0.05
158 0.07
159 0.07
160 0.07
161 0.07
162 0.09
163 0.1
164 0.1
165 0.1
166 0.09
167 0.1
168 0.11
169 0.13
170 0.11
171 0.11
172 0.11
173 0.11
174 0.1
175 0.11
176 0.11
177 0.09
178 0.09
179 0.09
180 0.1
181 0.12
182 0.11
183 0.11
184 0.1
185 0.11
186 0.13
187 0.13
188 0.12
189 0.11
190 0.12
191 0.11
192 0.12
193 0.12
194 0.09
195 0.1
196 0.11
197 0.13
198 0.13
199 0.15
200 0.16
201 0.16
202 0.17
203 0.18
204 0.25
205 0.28