Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P56628

Protein Details
Accession P56628   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-94YLKYLTKKYLKKNQLRDWIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG sce:YFL034C-A  -  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPNTSRKQKVIKTLTVDVSSPTENGVFDPASYSKYLIDHIKVDGAVGNLGNAIEVTEDGSIVTVVSSAKFSGKYLKYLTKKYLKKNQLRDWIRFVSIRQNQYKLVFYQVTPEDADEEEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.56
4 0.5
5 0.41
6 0.36
7 0.3
8 0.23
9 0.18
10 0.14
11 0.12
12 0.12
13 0.13
14 0.1
15 0.09
16 0.12
17 0.11
18 0.12
19 0.13
20 0.13
21 0.11
22 0.12
23 0.15
24 0.15
25 0.16
26 0.15
27 0.15
28 0.16
29 0.15
30 0.14
31 0.13
32 0.1
33 0.09
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.06
58 0.07
59 0.14
60 0.15
61 0.19
62 0.22
63 0.31
64 0.35
65 0.38
66 0.46
67 0.47
68 0.53
69 0.59
70 0.66
71 0.67
72 0.72
73 0.78
74 0.8
75 0.81
76 0.8
77 0.75
78 0.72
79 0.65
80 0.58
81 0.49
82 0.41
83 0.41
84 0.43
85 0.46
86 0.44
87 0.44
88 0.45
89 0.47
90 0.49
91 0.39
92 0.38
93 0.32
94 0.27
95 0.31
96 0.29
97 0.28
98 0.26
99 0.25
100 0.21
101 0.19
102 0.22