FuNGI

P37370

Protein Details

Accession

P37370

Localization Confidence

Medium

Confidence Score

10.1

NoLS Segment(s)

Position	Sequence	Protein Nature
786-805	SQMPKPRPFQNKTKLYPSGK	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 20, cyto_nucl 14.5, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR003124 WH2_dom
Gene Ontology	GO:0030479 C:actin cortical patch GO:0005935 C:cellular bud neck GO:0000131 C:incipient cellular bud site GO:0043332 C:mating projection tip GO:0003779 F:actin binding GO:0051666 P:actin cortical patch localization GO:0007121 P:bipolar cellular bud site selection GO:0006897 P:endocytosis GO:2000601 P:positive regulation of Arp2/3 complex-mediated actin nucleation GO:0032465 P:regulation of cytokinesis
KEGG	sce:YLR337C -
Pfam	View protein in Pfam PF02205 WH2
PROSITE	View protein in PROSITE PS51082 WH2
CDD	cd22064 WH2_WAS_WASL

Amino Acid Sequences

MAGAPAPPPPPPPPALGGSAPKPAKSVMQGRDALLGDIRKGMKLKKAETNDRSAPIVGGGVVSSASGSSGTVSSKGPSMSAPPIPGMGAPQLGDILAGGIPKLKHINNNASTKPSPSASAPPIPGAVPSVAAPPIPNAPLSPAPAVPSIPSSSAPPIPDIPSSAAPPIPIVPSSPAPPLPLSGASAPKVPQNRPHMPSVRPAHRSHQRKSSNISLPSVSAPPLPSASLPTHVSNPPQAPPPPPTPTIGLDSKNIKPTDNAVSPPSSEVPAGGLPFLAEINARRSERGAVEGVSSTKIQTENHKSPSQPPLPSSAPPIPTSHAPPLPPTAPPPPSLPNVTSAPKKATSAPAPPPPPLPAAMSSASTNSVKATPVPPTLAPPLPNTTSVPPNKASSMPAPPPPPPPPPGAFSTSSALSASSIPLAPLPPPPPPSVATSVPSAPPPPPTLTTNKPSASSKQSKISSSSSSSAVTPGGPLPFLAEIQKKRDDRFVVGGDTGYTTQDKQEDVIGSSKDDNVRPSPISPSINPPKQSSQNGMSFLDEIESKLHKQTSSNAFNAPPPHTDAMAPPLPPSAPPPPITSLPTPTASGDDHTNDKSETVLGMKKAKAPALPGHVPPPPVPPVLSDDSKNNVPAASLLHDVLPSSNLEKPPSPPVAAAPPLPTFSAPSLPQQSVSTSIPSPPPVAPTLSVRTETESISKNPTKSPPPPPSPSTMDTGTSNSPSKNLKQRLFSTGGSTLQHKHNTHTNQPDVDVGRYTIGGSNSIVGAKSGNERIVIDDSRFKWTNVSQMPKPRPFQNKTKLYPSGKGSSVPLDLTLFT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.34
2	0.37
3	0.37
4	0.39
5	0.37
6	0.44
7	0.42
8	0.38
9	0.36
10	0.33
11	0.32
12	0.34
13	0.4
14	0.36
15	0.43
16	0.45
17	0.44
18	0.49
19	0.45
20	0.38
21	0.33
22	0.29
23	0.22
24	0.25
25	0.25
26	0.22
27	0.26
28	0.29
29	0.33
30	0.39
31	0.45
32	0.49
33	0.57
34	0.65
35	0.67
36	0.71
37	0.69
38	0.64
39	0.6
40	0.51
41	0.42
42	0.32
43	0.27
44	0.18
45	0.12
46	0.09
47	0.07
48	0.06
49	0.05
50	0.05
51	0.04
52	0.04
53	0.04
54	0.04
55	0.05
56	0.07
57	0.08
58	0.1
59	0.11
60	0.12
61	0.14
62	0.15
63	0.14
64	0.14
65	0.18
66	0.21
67	0.23
68	0.24
69	0.22
70	0.22
71	0.22
72	0.21
73	0.18
74	0.15
75	0.13
76	0.12
77	0.11
78	0.11
79	0.1
80	0.1
81	0.07
82	0.06
83	0.06
84	0.05
85	0.05
86	0.09
87	0.09
88	0.12
89	0.17
90	0.19
91	0.25
92	0.32
93	0.43
94	0.47
95	0.54
96	0.54
97	0.56
98	0.54
99	0.51
100	0.47
101	0.38
102	0.33
103	0.28
104	0.33
105	0.32
106	0.36
107	0.34
108	0.33
109	0.32
110	0.3
111	0.27
112	0.22
113	0.17
114	0.12
115	0.11
116	0.12
117	0.11
118	0.11
119	0.11
120	0.11
121	0.13
122	0.13
123	0.13
124	0.11
125	0.15
126	0.18
127	0.2
128	0.21
129	0.18
130	0.2
131	0.21
132	0.21
133	0.17
134	0.17
135	0.16
136	0.16
137	0.16
138	0.16
139	0.19
140	0.21
141	0.21
142	0.21
143	0.22
144	0.23
145	0.23
146	0.22
147	0.22
148	0.21
149	0.22
150	0.21
151	0.19
152	0.17
153	0.17
154	0.16
155	0.14
156	0.12
157	0.12
158	0.14
159	0.15
160	0.18
161	0.19
162	0.19
163	0.19
164	0.19
165	0.19
166	0.18
167	0.17
168	0.17
169	0.17
170	0.19
171	0.18
172	0.2
173	0.19
174	0.22
175	0.27
176	0.28
177	0.33
178	0.39
179	0.47
180	0.48
181	0.56
182	0.56
183	0.53
184	0.59
185	0.6
186	0.59
187	0.56
188	0.56
189	0.57
190	0.61
191	0.67
192	0.64
193	0.65
194	0.64
195	0.63
196	0.66
197	0.67
198	0.65
199	0.6
200	0.57
201	0.47
202	0.41
203	0.39
204	0.34
205	0.25
206	0.18
207	0.15
208	0.14
209	0.14
210	0.13
211	0.11
212	0.14
213	0.14
214	0.16
215	0.18
216	0.19
217	0.22
218	0.23
219	0.24
220	0.26
221	0.27
222	0.25
223	0.28
224	0.29
225	0.28
226	0.31
227	0.35
228	0.35
229	0.35
230	0.35
231	0.32
232	0.32
233	0.34
234	0.33
235	0.28
236	0.28
237	0.31
238	0.32
239	0.36
240	0.34
241	0.29
242	0.27
243	0.29
244	0.32
245	0.3
246	0.28
247	0.24
248	0.25
249	0.25
250	0.26
251	0.23
252	0.16
253	0.14
254	0.12
255	0.11
256	0.11
257	0.11
258	0.09
259	0.07
260	0.06
261	0.07
262	0.06
263	0.05
264	0.04
265	0.06
266	0.1
267	0.15
268	0.16
269	0.16
270	0.17
271	0.2
272	0.2
273	0.21
274	0.18
275	0.14
276	0.14
277	0.15
278	0.15
279	0.13
280	0.13
281	0.1
282	0.1
283	0.11
284	0.12
285	0.19
286	0.27
287	0.32
288	0.38
289	0.4
290	0.4
291	0.43
292	0.51
293	0.49
294	0.42
295	0.36
296	0.37
297	0.37
298	0.37
299	0.37
300	0.32
301	0.29
302	0.28
303	0.28
304	0.24
305	0.24
306	0.27
307	0.26
308	0.24
309	0.22
310	0.22
311	0.24
312	0.23
313	0.22
314	0.22
315	0.23
316	0.23
317	0.24
318	0.26
319	0.25
320	0.27
321	0.28
322	0.26
323	0.23
324	0.25
325	0.27
326	0.26
327	0.24
328	0.25
329	0.24
330	0.24
331	0.22
332	0.24
333	0.25
334	0.29
335	0.32
336	0.36
337	0.37
338	0.37
339	0.36
340	0.32
341	0.3
342	0.25
343	0.21
344	0.15
345	0.16
346	0.16
347	0.16
348	0.14
349	0.14
350	0.15
351	0.13
352	0.12
353	0.1
354	0.1
355	0.09
356	0.1
357	0.11
358	0.12
359	0.13
360	0.14
361	0.14
362	0.15
363	0.19
364	0.19
365	0.19
366	0.17
367	0.2
368	0.19
369	0.2
370	0.19
371	0.18
372	0.24
373	0.24
374	0.25
375	0.23
376	0.23
377	0.23
378	0.23
379	0.22
380	0.18
381	0.22
382	0.22
383	0.24
384	0.25
385	0.25
386	0.29
387	0.31
388	0.32
389	0.29
390	0.3
391	0.28
392	0.29
393	0.3
394	0.29
395	0.26
396	0.25
397	0.24
398	0.21
399	0.19
400	0.16
401	0.13
402	0.1
403	0.09
404	0.07
405	0.06
406	0.06
407	0.05
408	0.06
409	0.06
410	0.06
411	0.09
412	0.1
413	0.12
414	0.15
415	0.16
416	0.18
417	0.19
418	0.21
419	0.23
420	0.22
421	0.21
422	0.2
423	0.2
424	0.19
425	0.18
426	0.16
427	0.12
428	0.13
429	0.14
430	0.14
431	0.16
432	0.18
433	0.23
434	0.26
435	0.29
436	0.33
437	0.31
438	0.31
439	0.31
440	0.32
441	0.36
442	0.38
443	0.38
444	0.4
445	0.42
446	0.41
447	0.43
448	0.42
449	0.36
450	0.33
451	0.31
452	0.25
453	0.23
454	0.22
455	0.19
456	0.16
457	0.12
458	0.1
459	0.09
460	0.08
461	0.07
462	0.07
463	0.07
464	0.07
465	0.08
466	0.1
467	0.14
468	0.16
469	0.21
470	0.29
471	0.29
472	0.3
473	0.36
474	0.35
475	0.32
476	0.35
477	0.33
478	0.27
479	0.25
480	0.24
481	0.18
482	0.17
483	0.14
484	0.1
485	0.09
486	0.07
487	0.08
488	0.1
489	0.09
490	0.09
491	0.11
492	0.12
493	0.12
494	0.16
495	0.15
496	0.15
497	0.15
498	0.17
499	0.17
500	0.17
501	0.19
502	0.17
503	0.2
504	0.2
505	0.2
506	0.22
507	0.24
508	0.26
509	0.24
510	0.31
511	0.37
512	0.41
513	0.43
514	0.42
515	0.44
516	0.47
517	0.49
518	0.45
519	0.41
520	0.4
521	0.41
522	0.38
523	0.32
524	0.26
525	0.23
526	0.19
527	0.13
528	0.1
529	0.1
530	0.11
531	0.11
532	0.13
533	0.15
534	0.15
535	0.16
536	0.24
537	0.31
538	0.35
539	0.35
540	0.35
541	0.34
542	0.36
543	0.39
544	0.33
545	0.25
546	0.24
547	0.23
548	0.22
549	0.21
550	0.19
551	0.22
552	0.22
553	0.2
554	0.16
555	0.16
556	0.16
557	0.15
558	0.19
559	0.18
560	0.19
561	0.21
562	0.24
563	0.27
564	0.29
565	0.33
566	0.3
567	0.29
568	0.29
569	0.28
570	0.26
571	0.23
572	0.23
573	0.19
574	0.19
575	0.17
576	0.16
577	0.18
578	0.18
579	0.19
580	0.17
581	0.16
582	0.15
583	0.13
584	0.11
585	0.11
586	0.14
587	0.15
588	0.2
589	0.21
590	0.25
591	0.27
592	0.29
593	0.27
594	0.28
595	0.3
596	0.33
597	0.35
598	0.32
599	0.34
600	0.34
601	0.35
602	0.32
603	0.31
604	0.27
605	0.24
606	0.23
607	0.2
608	0.24
609	0.27
610	0.28
611	0.25
612	0.25
613	0.28
614	0.3
615	0.29
616	0.23
617	0.19
618	0.17
619	0.16
620	0.15
621	0.13
622	0.13
623	0.12
624	0.12
625	0.12
626	0.12
627	0.12
628	0.11
629	0.09
630	0.1
631	0.14
632	0.15
633	0.18
634	0.2
635	0.22
636	0.28
637	0.31
638	0.29
639	0.26
640	0.27
641	0.3
642	0.3
643	0.29
644	0.26
645	0.23
646	0.24
647	0.24
648	0.21
649	0.17
650	0.17
651	0.2
652	0.18
653	0.23
654	0.27
655	0.27
656	0.28
657	0.27
658	0.27
659	0.26
660	0.26
661	0.23
662	0.19
663	0.21
664	0.22
665	0.23
666	0.24
667	0.2
668	0.22
669	0.21
670	0.22
671	0.21
672	0.23
673	0.27
674	0.27
675	0.28
676	0.26
677	0.29
678	0.28
679	0.28
680	0.27
681	0.26
682	0.26
683	0.33
684	0.37
685	0.34
686	0.38
687	0.44
688	0.47
689	0.51
690	0.59
691	0.6
692	0.64
693	0.69
694	0.67
695	0.67
696	0.65
697	0.6
698	0.54
699	0.46
700	0.4
701	0.35
702	0.35
703	0.31
704	0.29
705	0.29
706	0.25
707	0.27
708	0.29
709	0.35
710	0.42
711	0.49
712	0.5
713	0.56
714	0.6
715	0.63
716	0.63
717	0.56
718	0.52
719	0.46
720	0.43
721	0.37
722	0.36
723	0.33
724	0.35
725	0.43
726	0.38
727	0.39
728	0.45
729	0.5
730	0.56
731	0.61
732	0.6
733	0.53
734	0.53
735	0.54
736	0.47
737	0.42
738	0.35
739	0.27
740	0.22
741	0.2
742	0.2
743	0.18
744	0.16
745	0.15
746	0.14
747	0.14
748	0.14
749	0.15
750	0.14
751	0.1
752	0.1
753	0.11
754	0.16
755	0.18
756	0.18
757	0.19
758	0.19
759	0.23
760	0.28
761	0.28
762	0.26
763	0.3
764	0.31
765	0.38
766	0.39
767	0.35
768	0.36
769	0.36
770	0.43
771	0.43
772	0.5
773	0.49
774	0.58
775	0.67
776	0.7
777	0.73
778	0.72
779	0.74
780	0.73
781	0.77
782	0.77
783	0.77
784	0.76
785	0.8
786	0.81
787	0.76
788	0.76
789	0.72
790	0.67
791	0.59
792	0.55
793	0.48
794	0.43
795	0.4
796	0.33
797	0.28

P37370

3D AlphaFold-predicted Structure Viewer