Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P38305

Protein Details
Accession P38305    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35NLTERRVSKVQRPNKKKVRNQVESLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Gene Ontology GO:0005737  C:cytoplasm  
KEGG sce:YBR194W  -  
Pfam View protein in Pfam  
PF12622  NpwBP  
Amino Acid Sequences MDQKKDPSNNLTERRVSKVQRPNKKKVRNQVESLSRNLERNKEGQLLQTVSKGHLEADSGHSLGREKENGELGIRSIFYDKDWNPRGTAPSHYRNIPYNPATFKRRTEVQARLGNLENIKIPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.57
4 0.57
5 0.6
6 0.65
7 0.69
8 0.74
9 0.78
10 0.81
11 0.87
12 0.86
13 0.87
14 0.88
15 0.84
16 0.81
17 0.79
18 0.78
19 0.71
20 0.65
21 0.6
22 0.5
23 0.47
24 0.44
25 0.39
26 0.31
27 0.3
28 0.31
29 0.28
30 0.27
31 0.25
32 0.26
33 0.24
34 0.23
35 0.23
36 0.2
37 0.17
38 0.17
39 0.15
40 0.11
41 0.09
42 0.09
43 0.08
44 0.11
45 0.11
46 0.11
47 0.11
48 0.1
49 0.11
50 0.11
51 0.12
52 0.09
53 0.08
54 0.1
55 0.12
56 0.12
57 0.12
58 0.11
59 0.1
60 0.1
61 0.1
62 0.09
63 0.08
64 0.08
65 0.08
66 0.15
67 0.15
68 0.24
69 0.28
70 0.29
71 0.3
72 0.32
73 0.33
74 0.29
75 0.35
76 0.33
77 0.36
78 0.38
79 0.39
80 0.4
81 0.43
82 0.44
83 0.44
84 0.41
85 0.38
86 0.41
87 0.45
88 0.48
89 0.47
90 0.47
91 0.45
92 0.48
93 0.48
94 0.5
95 0.51
96 0.54
97 0.57
98 0.55
99 0.53
100 0.5
101 0.49
102 0.42
103 0.37