Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P11633

Protein Details
Accession P11633   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAATKEAKQPKEPKKRTTRRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
7-29AKQPKEPKKRTTRRKKDPNAPKR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0008301  F:DNA binding, bending  
GO:0043565  F:sequence-specific DNA binding  
GO:0006338  P:chromatin remodeling  
GO:0006281  P:DNA repair  
GO:0001195  P:maintenance of transcriptional fidelity during transcription elongation by RNA polymerase III  
GO:0070898  P:RNA polymerase III preinitiation complex assembly  
GO:0006366  P:transcription by RNA polymerase II  
KEGG sce:YBR089C-A  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAATKEAKQPKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESEKELYNATRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.88
3 0.9
4 0.91
5 0.92
6 0.92
7 0.95
8 0.95
9 0.94
10 0.95
11 0.94
12 0.93
13 0.86
14 0.77
15 0.7
16 0.62
17 0.54
18 0.45
19 0.36
20 0.28
21 0.26
22 0.24
23 0.19
24 0.18
25 0.17
26 0.16
27 0.14
28 0.11
29 0.1
30 0.11
31 0.12
32 0.15
33 0.16
34 0.17
35 0.2
36 0.2
37 0.2
38 0.19
39 0.19
40 0.15
41 0.12
42 0.12
43 0.1
44 0.09
45 0.09
46 0.09
47 0.09
48 0.1
49 0.12
50 0.11
51 0.11
52 0.12
53 0.11
54 0.12
55 0.18
56 0.21
57 0.28
58 0.32
59 0.32
60 0.33
61 0.35
62 0.36
63 0.32
64 0.31
65 0.27
66 0.32
67 0.41
68 0.46
69 0.52
70 0.57
71 0.6
72 0.67
73 0.66
74 0.64
75 0.61
76 0.59
77 0.59
78 0.55
79 0.54