FuNGI

Q12179

Protein Details

Accession

Q12179

Localization Confidence

Medium

Confidence Score

12.7

NoLS Segment(s)

Position	Sequence	Protein Nature
5-31	TSKAISRNVRSVKRPRRAPRPVVSTQA	Hydrophilic

NLS Segment(s)

Position	Sequence
16-22	VKRPRRA

Subcellular Location(s)

nucl 18, mito_nucl 13.5, mito 7

Family & Domain DBs

InterPro	View protein in InterPro IPR027417 P-loop_NTPase IPR018647 SLFN_3-like_DNA/RNA_helicase
Gene Ontology	GO:0005737 C:cytoplasm GO:0005634 C:nucleus
KEGG	sce:YPL245W -
Pfam	View protein in Pfam PF09848 DUF2075

Amino Acid Sequences

MHGPTSKAISRNVRSVKRPRRAPRPVVSTQAMNKLSNVTLSAEQEKLRERVLSFMRSNLSQYKSDWKHPAMFVIQGDAGTGKSVILNSLFNEIQKLSQFSPSSEDILHGTHNYLVVNHPEMLKLYIRISDSFKYISKSSLERPTSLINNLQKRKVMADVVIVDEAHLLATSKDAFKRFYGENHLKDLMSLCKVLVLVYDDKQALRMGSYWDEGSNNGATLKDFYNEIPPKSRDWYTLKQQFRVAAPQNVLNWIDQISVAGKIPPIESVLSKGNADCADDKIKNFDFKIWDDCGAMYEAIKEKDRQYGQCRMLSTYDFPYRLDGKDYYVECGDNFKVRWDRYTPREVTPWSERCDTIDEVGSVYTIQGFDLNYAGVILGRSIGYDAANDCIKLRPELYDDRAGFTKKKNIHNAEDVKQKIIMNSINVLLTRGVRGLYVYAYDPELRERLLRPSKK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.68
2	0.76
3	0.79
4	0.79
5	0.85
6	0.85
7	0.87
8	0.89
9	0.9
10	0.89
11	0.87
12	0.82
13	0.79
14	0.72
15	0.67
16	0.62
17	0.61
18	0.54
19	0.46
20	0.42
21	0.37
22	0.34
23	0.29
24	0.25
25	0.19
26	0.19
27	0.22
28	0.24
29	0.24
30	0.24
31	0.26
32	0.3
33	0.28
34	0.27
35	0.28
36	0.25
37	0.3
38	0.35
39	0.39
40	0.35
41	0.38
42	0.39
43	0.36
44	0.4
45	0.38
46	0.37
47	0.31
48	0.32
49	0.39
50	0.4
51	0.47
52	0.5
53	0.48
54	0.5
55	0.49
56	0.51
57	0.42
58	0.41
59	0.34
60	0.29
61	0.25
62	0.19
63	0.18
64	0.14
65	0.12
66	0.09
67	0.09
68	0.06
69	0.06
70	0.07
71	0.07
72	0.08
73	0.09
74	0.1
75	0.14
76	0.15
77	0.14
78	0.16
79	0.15
80	0.16
81	0.17
82	0.2
83	0.16
84	0.23
85	0.23
86	0.22
87	0.27
88	0.26
89	0.26
90	0.23
91	0.22
92	0.17
93	0.17
94	0.17
95	0.13
96	0.12
97	0.11
98	0.12
99	0.11
100	0.1
101	0.11
102	0.13
103	0.15
104	0.15
105	0.14
106	0.14
107	0.15
108	0.16
109	0.16
110	0.15
111	0.13
112	0.15
113	0.17
114	0.18
115	0.21
116	0.2
117	0.21
118	0.22
119	0.23
120	0.23
121	0.22
122	0.22
123	0.22
124	0.23
125	0.27
126	0.34
127	0.35
128	0.32
129	0.34
130	0.36
131	0.35
132	0.34
133	0.35
134	0.32
135	0.4
136	0.43
137	0.43
138	0.41
139	0.39
140	0.39
141	0.35
142	0.29
143	0.21
144	0.2
145	0.18
146	0.18
147	0.17
148	0.15
149	0.12
150	0.11
151	0.1
152	0.06
153	0.05
154	0.04
155	0.03
156	0.04
157	0.06
158	0.08
159	0.11
160	0.12
161	0.14
162	0.14
163	0.18
164	0.19
165	0.21
166	0.29
167	0.34
168	0.34
169	0.37
170	0.38
171	0.33
172	0.32
173	0.31
174	0.24
175	0.17
176	0.15
177	0.11
178	0.1
179	0.1
180	0.1
181	0.09
182	0.09
183	0.1
184	0.1
185	0.13
186	0.12
187	0.12
188	0.13
189	0.13
190	0.1
191	0.09
192	0.09
193	0.09
194	0.1
195	0.11
196	0.1
197	0.1
198	0.1
199	0.1
200	0.11
201	0.09
202	0.08
203	0.07
204	0.07
205	0.07
206	0.08
207	0.09
208	0.07
209	0.08
210	0.08
211	0.17
212	0.19
213	0.2
214	0.24
215	0.24
216	0.26
217	0.29
218	0.3
219	0.26
220	0.31
221	0.35
222	0.39
223	0.47
224	0.48
225	0.47
226	0.47
227	0.44
228	0.39
229	0.41
230	0.34
231	0.29
232	0.27
233	0.27
234	0.26
235	0.25
236	0.25
237	0.17
238	0.14
239	0.11
240	0.1
241	0.08
242	0.08
243	0.06
244	0.06
245	0.06
246	0.06
247	0.06
248	0.07
249	0.07
250	0.07
251	0.08
252	0.08
253	0.08
254	0.1
255	0.12
256	0.13
257	0.13
258	0.12
259	0.14
260	0.13
261	0.15
262	0.13
263	0.13
264	0.18
265	0.19
266	0.19
267	0.22
268	0.23
269	0.25
270	0.24
271	0.25
272	0.23
273	0.24
274	0.28
275	0.25
276	0.24
277	0.22
278	0.21
279	0.19
280	0.16
281	0.14
282	0.09
283	0.1
284	0.12
285	0.13
286	0.15
287	0.16
288	0.16
289	0.24
290	0.28
291	0.32
292	0.35
293	0.42
294	0.45
295	0.46
296	0.46
297	0.4
298	0.39
299	0.35
300	0.32
301	0.28
302	0.29
303	0.26
304	0.25
305	0.27
306	0.27
307	0.26
308	0.28
309	0.22
310	0.2
311	0.26
312	0.26
313	0.25
314	0.23
315	0.23
316	0.19
317	0.22
318	0.21
319	0.18
320	0.18
321	0.22
322	0.28
323	0.28
324	0.32
325	0.34
326	0.4
327	0.43
328	0.52
329	0.49
330	0.46
331	0.51
332	0.48
333	0.49
334	0.51
335	0.5
336	0.45
337	0.45
338	0.41
339	0.38
340	0.41
341	0.36
342	0.28
343	0.26
344	0.21
345	0.19
346	0.18
347	0.16
348	0.11
349	0.1
350	0.09
351	0.06
352	0.06
353	0.06
354	0.07
355	0.07
356	0.08
357	0.08
358	0.06
359	0.06
360	0.06
361	0.05
362	0.05
363	0.05
364	0.05
365	0.05
366	0.05
367	0.06
368	0.07
369	0.06
370	0.08
371	0.08
372	0.11
373	0.12
374	0.12
375	0.13
376	0.16
377	0.18
378	0.19
379	0.19
380	0.19
381	0.23
382	0.3
383	0.35
384	0.4
385	0.38
386	0.4
387	0.43
388	0.44
389	0.42
390	0.41
391	0.44
392	0.43
393	0.52
394	0.58
395	0.62
396	0.65
397	0.71
398	0.73
399	0.72
400	0.73
401	0.66
402	0.57
403	0.54
404	0.47
405	0.38
406	0.36
407	0.32
408	0.25
409	0.26
410	0.26
411	0.24
412	0.23
413	0.23
414	0.19
415	0.17
416	0.16
417	0.14
418	0.13
419	0.11
420	0.12
421	0.12
422	0.12
423	0.13
424	0.13
425	0.14
426	0.16
427	0.18
428	0.18
429	0.21
430	0.21
431	0.21
432	0.23
433	0.24
434	0.32

Q12179

3D AlphaFold-predicted Structure Viewer