Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q02950

Protein Details
Accession Q02950   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
308-329FFNKRPIYKPLTSRRARRPSVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016712  Mt_Rbsml_MRP51_fun  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
GO:0070124  P:mitochondrial translational initiation  
KEGG sce:YPL118W  -  
Pfam View protein in Pfam  
PF11709  Mit_ribos_Mrp51  
Amino Acid Sequences MTLAELLGRSRIAQVANNHKPLTYTGKKFHPTHQIIETKPSTLYRQEWGLKSAIPSKIKSRYLVYNDLDTLERITTFEPRGGTQWNRLRFQEMGVPIVSNIGRQNPFFKYISRPEDESHAKLSLFKEMKGDTDISPAAMKKRLKKITALIRSFQDEFKEWLVENHPDELKLNSNKLEDYVVKFLNKKLETKTNKKFNTEIIGTGGLSYSLPGKLKNSPNGVIQRTVVPGRILNVVKENNDNKWLAAIGGFVADVVFFQSPPSSFNSMGDFIRMKTFLFEILEASMEKNGSVSMHARLLEPQNDKTREFFNKRPIYKPLTSRRARRPSVGNIQEANNLLNIIKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.37
3 0.46
4 0.51
5 0.49
6 0.47
7 0.46
8 0.44
9 0.46
10 0.44
11 0.43
12 0.44
13 0.52
14 0.6
15 0.62
16 0.66
17 0.67
18 0.62
19 0.6
20 0.63
21 0.61
22 0.54
23 0.6
24 0.54
25 0.44
26 0.41
27 0.39
28 0.33
29 0.32
30 0.33
31 0.28
32 0.34
33 0.39
34 0.39
35 0.39
36 0.37
37 0.33
38 0.34
39 0.37
40 0.36
41 0.33
42 0.34
43 0.39
44 0.46
45 0.48
46 0.48
47 0.46
48 0.47
49 0.5
50 0.55
51 0.5
52 0.45
53 0.42
54 0.41
55 0.37
56 0.28
57 0.24
58 0.16
59 0.13
60 0.11
61 0.11
62 0.14
63 0.14
64 0.16
65 0.16
66 0.17
67 0.19
68 0.24
69 0.26
70 0.31
71 0.37
72 0.41
73 0.43
74 0.43
75 0.44
76 0.39
77 0.38
78 0.35
79 0.28
80 0.24
81 0.21
82 0.2
83 0.16
84 0.19
85 0.17
86 0.11
87 0.12
88 0.15
89 0.16
90 0.17
91 0.21
92 0.21
93 0.25
94 0.25
95 0.26
96 0.27
97 0.33
98 0.39
99 0.38
100 0.38
101 0.34
102 0.41
103 0.43
104 0.38
105 0.32
106 0.28
107 0.25
108 0.25
109 0.25
110 0.27
111 0.24
112 0.22
113 0.23
114 0.22
115 0.23
116 0.22
117 0.23
118 0.15
119 0.16
120 0.16
121 0.13
122 0.14
123 0.14
124 0.14
125 0.19
126 0.22
127 0.26
128 0.36
129 0.41
130 0.42
131 0.44
132 0.5
133 0.54
134 0.6
135 0.55
136 0.48
137 0.43
138 0.45
139 0.42
140 0.36
141 0.27
142 0.19
143 0.19
144 0.17
145 0.17
146 0.14
147 0.14
148 0.16
149 0.16
150 0.15
151 0.16
152 0.15
153 0.14
154 0.15
155 0.15
156 0.18
157 0.17
158 0.17
159 0.16
160 0.17
161 0.16
162 0.16
163 0.17
164 0.13
165 0.14
166 0.16
167 0.16
168 0.17
169 0.18
170 0.19
171 0.25
172 0.25
173 0.25
174 0.25
175 0.34
176 0.4
177 0.49
178 0.56
179 0.58
180 0.6
181 0.6
182 0.58
183 0.51
184 0.5
185 0.41
186 0.33
187 0.25
188 0.22
189 0.19
190 0.18
191 0.15
192 0.08
193 0.07
194 0.06
195 0.05
196 0.06
197 0.07
198 0.08
199 0.1
200 0.17
201 0.23
202 0.28
203 0.31
204 0.32
205 0.37
206 0.43
207 0.43
208 0.37
209 0.32
210 0.28
211 0.27
212 0.26
213 0.21
214 0.15
215 0.14
216 0.14
217 0.19
218 0.18
219 0.16
220 0.21
221 0.22
222 0.22
223 0.29
224 0.29
225 0.25
226 0.29
227 0.28
228 0.23
229 0.21
230 0.2
231 0.13
232 0.11
233 0.09
234 0.06
235 0.05
236 0.05
237 0.04
238 0.04
239 0.03
240 0.03
241 0.05
242 0.05
243 0.05
244 0.05
245 0.07
246 0.07
247 0.09
248 0.14
249 0.17
250 0.17
251 0.18
252 0.22
253 0.22
254 0.22
255 0.24
256 0.2
257 0.17
258 0.2
259 0.19
260 0.16
261 0.15
262 0.15
263 0.14
264 0.15
265 0.14
266 0.12
267 0.12
268 0.13
269 0.12
270 0.12
271 0.11
272 0.1
273 0.09
274 0.08
275 0.08
276 0.08
277 0.09
278 0.11
279 0.12
280 0.15
281 0.16
282 0.17
283 0.21
284 0.26
285 0.31
286 0.33
287 0.37
288 0.43
289 0.46
290 0.47
291 0.45
292 0.47
293 0.5
294 0.53
295 0.54
296 0.55
297 0.62
298 0.65
299 0.69
300 0.69
301 0.67
302 0.67
303 0.7
304 0.7
305 0.7
306 0.74
307 0.78
308 0.81
309 0.84
310 0.81
311 0.78
312 0.75
313 0.75
314 0.77
315 0.74
316 0.69
317 0.62
318 0.6
319 0.56
320 0.5
321 0.41
322 0.3
323 0.24
324 0.18