Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P38202

Protein Details
Accession P38202    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-106RDGRHHTYKKAKLMKQSKKKTSFTRFBasic
NLS Segment(s)
PositionSequence
72-100RKKISTSGWRDGRHHTYKKAKLMKQSKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0030687  C:preribosome, large subunit precursor  
KEGG sce:YBL028C  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRASSHLNAKSVKRRGVFQKAVDAREQRISDKLKEDLLKQKLEDLKKKEEQGIDMDVDEKKSNEEAPRKKISTSGWRDGRHHTYKKAKLMKQSKKKTSFTRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.57
4 0.49
5 0.53
6 0.59
7 0.64
8 0.63
9 0.56
10 0.59
11 0.57
12 0.57
13 0.56
14 0.49
15 0.41
16 0.42
17 0.4
18 0.31
19 0.33
20 0.34
21 0.32
22 0.33
23 0.31
24 0.29
25 0.3
26 0.32
27 0.35
28 0.35
29 0.34
30 0.31
31 0.34
32 0.35
33 0.39
34 0.43
35 0.39
36 0.42
37 0.44
38 0.46
39 0.44
40 0.39
41 0.35
42 0.3
43 0.27
44 0.2
45 0.16
46 0.16
47 0.13
48 0.13
49 0.12
50 0.1
51 0.09
52 0.09
53 0.12
54 0.18
55 0.27
56 0.32
57 0.39
58 0.46
59 0.46
60 0.46
61 0.47
62 0.47
63 0.48
64 0.5
65 0.52
66 0.53
67 0.55
68 0.58
69 0.61
70 0.64
71 0.63
72 0.61
73 0.6
74 0.63
75 0.66
76 0.74
77 0.76
78 0.72
79 0.73
80 0.79
81 0.81
82 0.81
83 0.85
84 0.86
85 0.85
86 0.88