Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P32338

Protein Details
Accession P32338   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
257-279NCPFPICQKTFRRKDAYKRHVAMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0046872  F:metal ion binding  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0051301  P:cell division  
GO:0045835  P:negative regulation of meiotic nuclear division  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0051038  P:negative regulation of transcription involved in meiotic cell cycle  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0071931  P:positive regulation of transcription involved in G1/S transition of mitotic cell cycle  
KEGG sce:YGR044C  -  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MSPCYGQNSAIAKGSWNREVLQEVQPIYHWHDFGQNMKEYSASPLEGDSSLPSSLPSSTEDCLLLSLENTITVIAGNQRQAYDSTSSTEEGTAPQLRPDEIADSTHCITSLVDPEFRDLINYGRQKGANPVFIESNTTEQSHSQCILGYPQKSHVAQLYHDPKVLSTISEGQTKRGSYHCSHCSEKFATLVEFAAHLDEFNLERPCKCPIEQCPWKILGFQQATGLRRHCASQHIGELDIEMEKSLNLKVEKYPGLNCPFPICQKTFRRKDAYKRHVAMVHNNADSRFNKRLKKILNNTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.31
4 0.3
5 0.29
6 0.33
7 0.33
8 0.33
9 0.32
10 0.29
11 0.28
12 0.28
13 0.28
14 0.31
15 0.31
16 0.25
17 0.21
18 0.26
19 0.28
20 0.32
21 0.36
22 0.34
23 0.31
24 0.31
25 0.31
26 0.26
27 0.28
28 0.25
29 0.19
30 0.15
31 0.14
32 0.16
33 0.15
34 0.15
35 0.12
36 0.12
37 0.11
38 0.11
39 0.11
40 0.1
41 0.1
42 0.11
43 0.13
44 0.13
45 0.14
46 0.15
47 0.15
48 0.14
49 0.14
50 0.13
51 0.11
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.08
62 0.1
63 0.12
64 0.12
65 0.13
66 0.14
67 0.15
68 0.17
69 0.17
70 0.15
71 0.16
72 0.17
73 0.18
74 0.17
75 0.16
76 0.14
77 0.12
78 0.15
79 0.16
80 0.14
81 0.16
82 0.16
83 0.16
84 0.17
85 0.17
86 0.15
87 0.12
88 0.14
89 0.13
90 0.15
91 0.16
92 0.15
93 0.14
94 0.12
95 0.11
96 0.11
97 0.15
98 0.13
99 0.14
100 0.14
101 0.16
102 0.17
103 0.16
104 0.15
105 0.11
106 0.11
107 0.17
108 0.19
109 0.19
110 0.21
111 0.22
112 0.22
113 0.29
114 0.3
115 0.27
116 0.26
117 0.26
118 0.24
119 0.23
120 0.25
121 0.18
122 0.17
123 0.14
124 0.14
125 0.13
126 0.13
127 0.15
128 0.14
129 0.14
130 0.11
131 0.1
132 0.1
133 0.14
134 0.16
135 0.16
136 0.15
137 0.17
138 0.21
139 0.21
140 0.21
141 0.2
142 0.17
143 0.17
144 0.25
145 0.27
146 0.24
147 0.26
148 0.25
149 0.21
150 0.23
151 0.22
152 0.14
153 0.1
154 0.14
155 0.15
156 0.21
157 0.21
158 0.21
159 0.24
160 0.24
161 0.24
162 0.22
163 0.25
164 0.22
165 0.3
166 0.33
167 0.36
168 0.39
169 0.39
170 0.41
171 0.38
172 0.35
173 0.29
174 0.24
175 0.19
176 0.16
177 0.15
178 0.11
179 0.09
180 0.08
181 0.08
182 0.06
183 0.06
184 0.05
185 0.06
186 0.06
187 0.1
188 0.13
189 0.13
190 0.14
191 0.16
192 0.2
193 0.22
194 0.22
195 0.26
196 0.29
197 0.39
198 0.46
199 0.47
200 0.47
201 0.47
202 0.46
203 0.4
204 0.36
205 0.34
206 0.28
207 0.26
208 0.27
209 0.29
210 0.31
211 0.34
212 0.33
213 0.26
214 0.25
215 0.26
216 0.22
217 0.22
218 0.25
219 0.25
220 0.29
221 0.28
222 0.28
223 0.27
224 0.25
225 0.21
226 0.17
227 0.13
228 0.08
229 0.07
230 0.06
231 0.07
232 0.07
233 0.12
234 0.12
235 0.14
236 0.17
237 0.23
238 0.26
239 0.28
240 0.3
241 0.33
242 0.38
243 0.38
244 0.36
245 0.35
246 0.36
247 0.39
248 0.42
249 0.37
250 0.41
251 0.49
252 0.59
253 0.63
254 0.68
255 0.73
256 0.75
257 0.83
258 0.85
259 0.85
260 0.85
261 0.79
262 0.77
263 0.73
264 0.68
265 0.67
266 0.65
267 0.62
268 0.54
269 0.52
270 0.46
271 0.47
272 0.45
273 0.42
274 0.42
275 0.43
276 0.48
277 0.53
278 0.61
279 0.65
280 0.74