Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P22354

Protein Details
Accession P22354    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
168-195QEIQSRWKEKRRIAREDRKRRKLLWYQAHydrophilic
NLS Segment(s)
PositionSequence
174-189WKEKRRIAREDRKRRK
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG sce:YKR085C  -  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MIGRGVCCRSFHTAGSAWKQFGFPKTQVTTIYNKTKSASNYKGYLKHRDAPGMYYQPSESIATGSVNSETIPRSFMAASDPRRGLDMPVQSTKAKQCPNVLVGKSTVNGKTYHLGPQEIDEIRKLRLDNPQKYTRKFLAAKYGISPLFVSMVSKPSEQHVQIMESRLQEIQSRWKEKRRIAREDRKRRKLLWYQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.46
4 0.39
5 0.38
6 0.38
7 0.37
8 0.35
9 0.35
10 0.29
11 0.33
12 0.34
13 0.36
14 0.38
15 0.37
16 0.4
17 0.41
18 0.49
19 0.43
20 0.42
21 0.41
22 0.42
23 0.44
24 0.46
25 0.45
26 0.4
27 0.44
28 0.48
29 0.55
30 0.55
31 0.59
32 0.55
33 0.55
34 0.53
35 0.53
36 0.48
37 0.43
38 0.45
39 0.4
40 0.36
41 0.3
42 0.28
43 0.23
44 0.24
45 0.21
46 0.14
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.08
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.09
59 0.08
60 0.09
61 0.09
62 0.09
63 0.13
64 0.18
65 0.21
66 0.25
67 0.25
68 0.24
69 0.25
70 0.25
71 0.22
72 0.21
73 0.21
74 0.2
75 0.21
76 0.24
77 0.22
78 0.24
79 0.26
80 0.27
81 0.26
82 0.25
83 0.25
84 0.26
85 0.29
86 0.32
87 0.29
88 0.24
89 0.23
90 0.21
91 0.19
92 0.19
93 0.17
94 0.13
95 0.13
96 0.13
97 0.15
98 0.15
99 0.19
100 0.18
101 0.18
102 0.16
103 0.17
104 0.21
105 0.19
106 0.19
107 0.16
108 0.16
109 0.16
110 0.18
111 0.17
112 0.16
113 0.24
114 0.34
115 0.39
116 0.45
117 0.54
118 0.58
119 0.6
120 0.64
121 0.57
122 0.56
123 0.52
124 0.47
125 0.48
126 0.44
127 0.43
128 0.39
129 0.41
130 0.32
131 0.3
132 0.27
133 0.17
134 0.15
135 0.14
136 0.13
137 0.09
138 0.13
139 0.14
140 0.14
141 0.14
142 0.17
143 0.23
144 0.22
145 0.25
146 0.23
147 0.24
148 0.27
149 0.3
150 0.29
151 0.24
152 0.25
153 0.22
154 0.21
155 0.21
156 0.21
157 0.28
158 0.35
159 0.42
160 0.47
161 0.56
162 0.63
163 0.68
164 0.77
165 0.75
166 0.77
167 0.8
168 0.85
169 0.87
170 0.9
171 0.93
172 0.93
173 0.9
174 0.83
175 0.82