Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P43587

Protein Details
Accession P43587    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-138LDFNERRQRRLERRHRKLEKKRSYSPNAYEBasic
NLS Segment(s)
PositionSequence
114-130RRQRRLERRHRKLEKKR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0000164  C:protein phosphatase type 1 complex  
GO:0008157  F:protein phosphatase 1 binding  
GO:0072542  F:protein phosphatase activator activity  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0051276  P:chromosome organization  
GO:0005977  P:glycogen metabolic process  
GO:0006873  P:intracellular monoatomic ion homeostasis  
GO:0007094  P:mitotic spindle assembly checkpoint signaling  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
GO:0035308  P:negative regulation of protein dephosphorylation  
GO:1905183  P:negative regulation of protein serine/threonine phosphatase activity  
GO:0035307  P:positive regulation of protein dephosphorylation  
GO:1900180  P:regulation of protein localization to nucleus  
KEGG sce:YFR003C  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSGNQMAMGSEQQQTVGSRTVSVEEVPAVLQLRATQDPPRSQEAMPTRHNVRWEENVIDNENMNKKKTKICCIFHPQNEDEEECNHHSDDDGSSSSGSSSSESENEKDLDFNERRQRRLERRHRKLEKKRSYSPNAYEIQPDYSEYRRKQQEKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.19
4 0.17
5 0.15
6 0.16
7 0.18
8 0.17
9 0.16
10 0.14
11 0.11
12 0.11
13 0.1
14 0.11
15 0.1
16 0.09
17 0.09
18 0.09
19 0.13
20 0.14
21 0.16
22 0.19
23 0.24
24 0.29
25 0.32
26 0.36
27 0.35
28 0.33
29 0.39
30 0.41
31 0.42
32 0.4
33 0.42
34 0.4
35 0.4
36 0.43
37 0.38
38 0.36
39 0.35
40 0.34
41 0.32
42 0.31
43 0.31
44 0.3
45 0.27
46 0.23
47 0.21
48 0.25
49 0.23
50 0.22
51 0.23
52 0.23
53 0.29
54 0.33
55 0.4
56 0.42
57 0.44
58 0.5
59 0.57
60 0.62
61 0.59
62 0.6
63 0.51
64 0.44
65 0.42
66 0.36
67 0.27
68 0.21
69 0.2
70 0.16
71 0.16
72 0.14
73 0.13
74 0.11
75 0.11
76 0.11
77 0.1
78 0.09
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.06
86 0.07
87 0.08
88 0.1
89 0.12
90 0.13
91 0.15
92 0.16
93 0.15
94 0.14
95 0.14
96 0.2
97 0.19
98 0.25
99 0.34
100 0.37
101 0.39
102 0.45
103 0.54
104 0.57
105 0.66
106 0.71
107 0.72
108 0.78
109 0.88
110 0.92
111 0.93
112 0.94
113 0.94
114 0.94
115 0.91
116 0.91
117 0.89
118 0.88
119 0.86
120 0.8
121 0.76
122 0.68
123 0.6
124 0.54
125 0.46
126 0.41
127 0.33
128 0.3
129 0.26
130 0.29
131 0.37
132 0.36
133 0.44
134 0.51
135 0.59