Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0N1NYY4

Protein Details
Accession A0A0N1NYY4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
248-272GNGHEKHKKGGKKEEKEDKKKDDESBasic
275-312EDEGKDDKKDDKKDAKKDSKKDDKKDDKKEEKKDDKKKBasic
NLS Segment(s)
PositionSequence
236-268IKAREKDEKRLRGNGHEKHKKGGKKEEKEDKKK
280-312DDKKDDKKDAKKDSKKDDKKDDKKEEKKDDKKK
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 2, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007667  Hypoxia_induced_domain  
IPR040153  Rcf2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04588  HIG_1_N  
PROSITE View protein in PROSITE  
PS51503  HIG1  
Amino Acid Sequences MKILTKEEEAEHYRETLKGGSLGGVLGLGVGFAGVALASQRYHFIRTLTLPLKAFLVTSSGTFAGIVTADHFSRAYEFKRNPKNVEYAERNRELHAEQEAGKTFAERGLEWARAERYKIVGGSWILSMVTAFAIVNRDKYLTGAQKIVQARVYAQFLTLGVLVASAAFEISDQRKQQGRYETVKYVDPNDPEHKRVLEKQVEVGGKGSGSAYGGQREDRQGRDLWKDMVESEEERIKAREKDEKRLRGNGHEKHKKGGKKEEKEDKKKDDESEDEDEGKDDKKDDKKDAKKDSKKDDKKDDKKEEKKDDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.22
4 0.2
5 0.18
6 0.17
7 0.15
8 0.14
9 0.13
10 0.11
11 0.09
12 0.07
13 0.05
14 0.04
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.03
24 0.04
25 0.05
26 0.06
27 0.1
28 0.11
29 0.14
30 0.16
31 0.17
32 0.2
33 0.23
34 0.31
35 0.3
36 0.33
37 0.31
38 0.3
39 0.3
40 0.26
41 0.23
42 0.14
43 0.14
44 0.1
45 0.1
46 0.11
47 0.1
48 0.1
49 0.1
50 0.1
51 0.08
52 0.07
53 0.07
54 0.06
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.11
61 0.14
62 0.16
63 0.23
64 0.28
65 0.37
66 0.48
67 0.53
68 0.55
69 0.56
70 0.6
71 0.56
72 0.59
73 0.59
74 0.57
75 0.58
76 0.58
77 0.55
78 0.48
79 0.46
80 0.38
81 0.31
82 0.25
83 0.2
84 0.17
85 0.19
86 0.2
87 0.18
88 0.17
89 0.15
90 0.13
91 0.13
92 0.13
93 0.09
94 0.13
95 0.15
96 0.17
97 0.17
98 0.2
99 0.21
100 0.21
101 0.22
102 0.18
103 0.17
104 0.17
105 0.17
106 0.14
107 0.14
108 0.14
109 0.13
110 0.12
111 0.1
112 0.08
113 0.08
114 0.08
115 0.05
116 0.04
117 0.03
118 0.03
119 0.03
120 0.06
121 0.07
122 0.08
123 0.08
124 0.09
125 0.09
126 0.1
127 0.14
128 0.15
129 0.17
130 0.17
131 0.18
132 0.23
133 0.23
134 0.23
135 0.2
136 0.17
137 0.16
138 0.17
139 0.17
140 0.12
141 0.11
142 0.1
143 0.08
144 0.09
145 0.08
146 0.05
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.02
153 0.02
154 0.02
155 0.02
156 0.04
157 0.06
158 0.1
159 0.11
160 0.14
161 0.19
162 0.21
163 0.26
164 0.32
165 0.36
166 0.38
167 0.42
168 0.42
169 0.39
170 0.41
171 0.36
172 0.32
173 0.3
174 0.26
175 0.27
176 0.31
177 0.32
178 0.31
179 0.32
180 0.3
181 0.29
182 0.32
183 0.36
184 0.34
185 0.32
186 0.33
187 0.37
188 0.35
189 0.33
190 0.29
191 0.2
192 0.14
193 0.14
194 0.12
195 0.06
196 0.06
197 0.08
198 0.09
199 0.11
200 0.12
201 0.13
202 0.15
203 0.21
204 0.24
205 0.24
206 0.25
207 0.26
208 0.3
209 0.33
210 0.34
211 0.3
212 0.28
213 0.26
214 0.24
215 0.22
216 0.2
217 0.16
218 0.16
219 0.18
220 0.17
221 0.18
222 0.2
223 0.22
224 0.24
225 0.27
226 0.34
227 0.35
228 0.45
229 0.54
230 0.62
231 0.63
232 0.68
233 0.67
234 0.68
235 0.73
236 0.7
237 0.71
238 0.72
239 0.68
240 0.68
241 0.72
242 0.68
243 0.66
244 0.69
245 0.69
246 0.69
247 0.78
248 0.8
249 0.84
250 0.88
251 0.9
252 0.86
253 0.84
254 0.79
255 0.74
256 0.7
257 0.64
258 0.6
259 0.57
260 0.52
261 0.44
262 0.39
263 0.36
264 0.3
265 0.26
266 0.21
267 0.17
268 0.22
269 0.3
270 0.36
271 0.45
272 0.54
273 0.63
274 0.71
275 0.8
276 0.84
277 0.85
278 0.88
279 0.89
280 0.89
281 0.9
282 0.9
283 0.9
284 0.9
285 0.91
286 0.92
287 0.93
288 0.92
289 0.92
290 0.93
291 0.93
292 0.93