Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0N1H2L0

Protein Details
Accession A0A0N1H2L0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
145-171DKAQAVPEPSKPRKKAKKIKLSFDDPDHydrophilic
NLS Segment(s)
PositionSequence
154-164SKPRKKAKKIK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.333, mito_nucl 12.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPSQKLEFTKQEPSFLRRLREEHGGPRNNVQAPRPKKDRLRTGDDDEDEPVIVDESGENVVAKEEWEGMLKREKEGVEAEAGRDDDVEKADEAVASAMAKEVQKAEIGTTKKRKVVKVIGQEEPADTPKSKRDDQSATTTSDGTDKAQAVPEPSKPRKKAKKIKLSFDDPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.55
4 0.49
5 0.52
6 0.48
7 0.52
8 0.52
9 0.52
10 0.57
11 0.57
12 0.54
13 0.55
14 0.57
15 0.53
16 0.51
17 0.47
18 0.47
19 0.48
20 0.55
21 0.57
22 0.58
23 0.62
24 0.69
25 0.75
26 0.71
27 0.73
28 0.71
29 0.72
30 0.71
31 0.64
32 0.56
33 0.46
34 0.39
35 0.3
36 0.24
37 0.16
38 0.09
39 0.07
40 0.06
41 0.04
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.08
54 0.08
55 0.09
56 0.17
57 0.17
58 0.17
59 0.2
60 0.19
61 0.19
62 0.19
63 0.19
64 0.14
65 0.14
66 0.14
67 0.12
68 0.12
69 0.1
70 0.09
71 0.08
72 0.06
73 0.06
74 0.07
75 0.05
76 0.06
77 0.06
78 0.06
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.03
85 0.05
86 0.05
87 0.05
88 0.06
89 0.06
90 0.07
91 0.08
92 0.09
93 0.13
94 0.16
95 0.24
96 0.31
97 0.35
98 0.39
99 0.44
100 0.45
101 0.47
102 0.54
103 0.55
104 0.57
105 0.59
106 0.57
107 0.54
108 0.52
109 0.45
110 0.37
111 0.31
112 0.23
113 0.19
114 0.17
115 0.22
116 0.27
117 0.3
118 0.32
119 0.37
120 0.41
121 0.44
122 0.51
123 0.47
124 0.45
125 0.42
126 0.38
127 0.31
128 0.27
129 0.24
130 0.17
131 0.18
132 0.16
133 0.16
134 0.19
135 0.2
136 0.22
137 0.25
138 0.3
139 0.37
140 0.46
141 0.54
142 0.58
143 0.68
144 0.74
145 0.82
146 0.86
147 0.87
148 0.89
149 0.88
150 0.92
151 0.9