Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8MMS8

Protein Details
Accession A0A0M8MMS8   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAQRLTLRKRNPYNTRSNRRRVVKTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRLTLRKRNPYNTRSNRRRVVKTPSGELRYLHIKKLPTAPKCGDCHTILPGVKALRPRAYATVSKREKTVQRAYGGSRCADCVRTRVIRAFLVEESKIVKNVLKAQQAKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.86
4 0.86
5 0.85
6 0.84
7 0.84
8 0.8
9 0.79
10 0.76
11 0.71
12 0.7
13 0.68
14 0.64
15 0.57
16 0.51
17 0.44
18 0.45
19 0.42
20 0.37
21 0.32
22 0.29
23 0.3
24 0.39
25 0.43
26 0.36
27 0.41
28 0.42
29 0.45
30 0.46
31 0.47
32 0.42
33 0.35
34 0.33
35 0.29
36 0.3
37 0.23
38 0.21
39 0.2
40 0.17
41 0.17
42 0.19
43 0.19
44 0.17
45 0.19
46 0.19
47 0.2
48 0.23
49 0.27
50 0.28
51 0.36
52 0.38
53 0.37
54 0.37
55 0.39
56 0.41
57 0.43
58 0.47
59 0.41
60 0.41
61 0.42
62 0.45
63 0.44
64 0.41
65 0.35
66 0.27
67 0.24
68 0.23
69 0.23
70 0.21
71 0.19
72 0.24
73 0.26
74 0.29
75 0.31
76 0.32
77 0.31
78 0.32
79 0.32
80 0.28
81 0.28
82 0.25
83 0.22
84 0.22
85 0.22
86 0.21
87 0.19
88 0.19
89 0.19
90 0.28
91 0.35
92 0.4
93 0.44