Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VRC1

Protein Details
Accession A0A0M9VRC1    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
83-127TYGSEYQPSQRKRKRKHGFLARLRSRTGKKVLVRRRAKGKARVSHHydrophilic
NLS Segment(s)
PositionSequence
93-126RKRKRKHGFLARLRSRTGKKVLVRRRAKGKARVS
Subcellular Location(s) mito 23, cyto_nucl 2.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MTLPRFASVRHVRLLAPPKVVPRVYVDTPRTPSLLSQAASSSCTRFKPTTMRVSSPLLAMARQALATRPIPVYTPLGGVRFTTYGSEYQPSQRKRKRKHGFLARLRSRTGKKVLVRRRAKGKARVSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.4
4 0.39
5 0.4
6 0.45
7 0.44
8 0.37
9 0.35
10 0.37
11 0.36
12 0.42
13 0.42
14 0.42
15 0.46
16 0.46
17 0.4
18 0.34
19 0.31
20 0.27
21 0.27
22 0.21
23 0.18
24 0.17
25 0.17
26 0.19
27 0.19
28 0.17
29 0.15
30 0.16
31 0.19
32 0.19
33 0.21
34 0.27
35 0.32
36 0.4
37 0.41
38 0.42
39 0.41
40 0.44
41 0.41
42 0.33
43 0.29
44 0.2
45 0.16
46 0.13
47 0.11
48 0.07
49 0.07
50 0.07
51 0.05
52 0.08
53 0.08
54 0.1
55 0.1
56 0.1
57 0.1
58 0.12
59 0.13
60 0.11
61 0.13
62 0.12
63 0.13
64 0.13
65 0.13
66 0.12
67 0.11
68 0.11
69 0.1
70 0.1
71 0.1
72 0.11
73 0.13
74 0.13
75 0.2
76 0.28
77 0.33
78 0.43
79 0.5
80 0.59
81 0.67
82 0.77
83 0.8
84 0.82
85 0.87
86 0.88
87 0.9
88 0.9
89 0.92
90 0.9
91 0.82
92 0.75
93 0.72
94 0.66
95 0.62
96 0.59
97 0.56
98 0.55
99 0.62
100 0.7
101 0.72
102 0.76
103 0.77
104 0.81
105 0.83
106 0.84
107 0.83