Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M9VPZ6

Protein Details
Accession A0A0M9VPZ6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
206-230VAHAAASRKKRKAKQVDNDTTKRVRHydrophilic
NLS Segment(s)
PositionSequence
213-218RKKRKA
Subcellular Location(s) nucl 10, cyto 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIARRDDLVKTKATGPISVDRDEMRHTQWTLCRISRQKLRAPIMIDRLGQLYNKEALIEYLLRKSTKTVSEAETKVAGHIRGLKDVRQVQLHVNPTHEAAGGDALYYPYACPLTQRVMNGKHKFVCLWPCGCVMSETGLRETAFPGQKKRPEDKATTPCPQCGVLFGHDALWKDEPSVDADLIWLYPPTATQAMLREQLVAHAAASRKKRKAKQVDNDTTKRVRAAVDVDTTPSLNQTAPGAYAVQQVRAAQAQAAQHEAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.32
4 0.34
5 0.39
6 0.39
7 0.35
8 0.31
9 0.36
10 0.37
11 0.36
12 0.35
13 0.3
14 0.31
15 0.32
16 0.31
17 0.25
18 0.27
19 0.27
20 0.31
21 0.34
22 0.38
23 0.4
24 0.41
25 0.46
26 0.47
27 0.55
28 0.58
29 0.6
30 0.62
31 0.65
32 0.68
33 0.63
34 0.61
35 0.58
36 0.56
37 0.53
38 0.46
39 0.37
40 0.33
41 0.29
42 0.26
43 0.21
44 0.17
45 0.15
46 0.15
47 0.14
48 0.12
49 0.11
50 0.13
51 0.15
52 0.13
53 0.15
54 0.18
55 0.18
56 0.18
57 0.2
58 0.23
59 0.24
60 0.25
61 0.24
62 0.25
63 0.33
64 0.33
65 0.33
66 0.29
67 0.26
68 0.25
69 0.24
70 0.2
71 0.14
72 0.19
73 0.18
74 0.23
75 0.24
76 0.24
77 0.29
78 0.32
79 0.34
80 0.3
81 0.3
82 0.28
83 0.32
84 0.36
85 0.3
86 0.28
87 0.26
88 0.25
89 0.24
90 0.21
91 0.14
92 0.09
93 0.09
94 0.07
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.05
103 0.05
104 0.06
105 0.08
106 0.11
107 0.13
108 0.15
109 0.19
110 0.26
111 0.36
112 0.38
113 0.39
114 0.37
115 0.36
116 0.35
117 0.33
118 0.31
119 0.24
120 0.22
121 0.2
122 0.19
123 0.19
124 0.19
125 0.16
126 0.11
127 0.11
128 0.12
129 0.11
130 0.11
131 0.12
132 0.12
133 0.11
134 0.12
135 0.15
136 0.18
137 0.19
138 0.24
139 0.29
140 0.34
141 0.4
142 0.45
143 0.47
144 0.48
145 0.52
146 0.56
147 0.59
148 0.6
149 0.62
150 0.58
151 0.5
152 0.46
153 0.41
154 0.31
155 0.25
156 0.22
157 0.15
158 0.16
159 0.15
160 0.16
161 0.17
162 0.17
163 0.17
164 0.16
165 0.14
166 0.13
167 0.13
168 0.12
169 0.13
170 0.13
171 0.11
172 0.1
173 0.1
174 0.1
175 0.09
176 0.09
177 0.06
178 0.05
179 0.04
180 0.05
181 0.08
182 0.08
183 0.09
184 0.1
185 0.13
186 0.16
187 0.18
188 0.18
189 0.16
190 0.15
191 0.16
192 0.15
193 0.13
194 0.1
195 0.11
196 0.13
197 0.18
198 0.27
199 0.34
200 0.41
201 0.5
202 0.58
203 0.65
204 0.74
205 0.79
206 0.82
207 0.85
208 0.88
209 0.88
210 0.86
211 0.81
212 0.73
213 0.64
214 0.54
215 0.44
216 0.34
217 0.28
218 0.27
219 0.25
220 0.25
221 0.25
222 0.26
223 0.25
224 0.25
225 0.22
226 0.19
227 0.16
228 0.12
229 0.12
230 0.11
231 0.11
232 0.11
233 0.12
234 0.12
235 0.12
236 0.19
237 0.19
238 0.2
239 0.21
240 0.2
241 0.22
242 0.22
243 0.22
244 0.15
245 0.18
246 0.19
247 0.19
248 0.22