Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M9VR01

Protein Details
Accession A0A0M9VR01    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-41KNPWRLSSTRKARVRQRLRDVDHydrophilic
82-107GVNFRKSVHKVPKWTRKTLRVNPRGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, pero 3, nucl 1, cyto 1, plas 1, cyto_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MSFLGAFRPTSAAFGGLLWKNPWRLSSTRKARVRQRLRDVDTVIETIRASGVQCRALDRDLRLPKEQEMHPRDKYTVFSPTGVNFRKSVHKVPKWTRKTLRVNPRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.17
3 0.15
4 0.17
5 0.17
6 0.2
7 0.22
8 0.23
9 0.24
10 0.22
11 0.25
12 0.31
13 0.4
14 0.47
15 0.54
16 0.6
17 0.67
18 0.71
19 0.78
20 0.81
21 0.8
22 0.8
23 0.8
24 0.78
25 0.75
26 0.67
27 0.58
28 0.49
29 0.4
30 0.3
31 0.21
32 0.15
33 0.1
34 0.09
35 0.07
36 0.06
37 0.07
38 0.09
39 0.11
40 0.11
41 0.12
42 0.14
43 0.15
44 0.16
45 0.16
46 0.23
47 0.26
48 0.29
49 0.3
50 0.3
51 0.31
52 0.34
53 0.36
54 0.37
55 0.38
56 0.41
57 0.42
58 0.43
59 0.43
60 0.39
61 0.38
62 0.31
63 0.31
64 0.26
65 0.24
66 0.24
67 0.25
68 0.32
69 0.32
70 0.31
71 0.26
72 0.27
73 0.35
74 0.39
75 0.46
76 0.48
77 0.52
78 0.61
79 0.71
80 0.79
81 0.77
82 0.82
83 0.82
84 0.81
85 0.85
86 0.85
87 0.85