Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8MK12

Protein Details
Accession A0A0M8MK12    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-41TNEHEMPPLKRKRGRPRKEAMDNTASHydrophilic
59-84MNDGTTPKRKRGRPRKRPLEPHEEVABasic
NLS Segment(s)
PositionSequence
24-33LKRKRGRPRK
65-76PKRKRGRPRKRP
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, pero 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MEPNRDAQTVKPKPDTNEHEMPPLKRKRGRPRKEAMDNTASMPVPKPQPIITPSTPPPMNDGTTPKRKRGRPRKRPLEPHEEVALMAAKQSSNIPPWRIMESVDRPPVYPETHVFLRTPRPIQAVKLWDSPERAPRPRAQWWHYRRPTLRHVPAHRADGQTAEPLPTPPPGRRPKTRVDYAALQHRQLAHRARGIHLDLPKLWKARVRQAKDQPLTHDTRTASSSPAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.66
3 0.63
4 0.64
5 0.59
6 0.6
7 0.61
8 0.6
9 0.6
10 0.61
11 0.62
12 0.61
13 0.69
14 0.72
15 0.78
16 0.84
17 0.84
18 0.85
19 0.87
20 0.9
21 0.87
22 0.83
23 0.78
24 0.69
25 0.62
26 0.55
27 0.45
28 0.35
29 0.28
30 0.26
31 0.23
32 0.23
33 0.23
34 0.2
35 0.26
36 0.28
37 0.34
38 0.32
39 0.34
40 0.35
41 0.4
42 0.4
43 0.34
44 0.36
45 0.31
46 0.3
47 0.27
48 0.32
49 0.32
50 0.42
51 0.45
52 0.49
53 0.55
54 0.6
55 0.69
56 0.73
57 0.77
58 0.77
59 0.86
60 0.88
61 0.9
62 0.94
63 0.9
64 0.89
65 0.81
66 0.73
67 0.64
68 0.53
69 0.42
70 0.32
71 0.25
72 0.15
73 0.12
74 0.08
75 0.06
76 0.06
77 0.08
78 0.09
79 0.12
80 0.15
81 0.16
82 0.18
83 0.2
84 0.22
85 0.21
86 0.21
87 0.23
88 0.24
89 0.28
90 0.3
91 0.28
92 0.26
93 0.27
94 0.28
95 0.23
96 0.2
97 0.16
98 0.16
99 0.17
100 0.18
101 0.16
102 0.16
103 0.2
104 0.22
105 0.23
106 0.2
107 0.23
108 0.22
109 0.24
110 0.27
111 0.26
112 0.26
113 0.28
114 0.28
115 0.26
116 0.28
117 0.28
118 0.32
119 0.34
120 0.34
121 0.34
122 0.37
123 0.41
124 0.46
125 0.51
126 0.48
127 0.52
128 0.56
129 0.64
130 0.65
131 0.68
132 0.64
133 0.63
134 0.67
135 0.67
136 0.68
137 0.66
138 0.66
139 0.66
140 0.65
141 0.64
142 0.59
143 0.5
144 0.42
145 0.35
146 0.31
147 0.25
148 0.22
149 0.18
150 0.14
151 0.13
152 0.14
153 0.16
154 0.18
155 0.18
156 0.28
157 0.36
158 0.43
159 0.51
160 0.56
161 0.62
162 0.68
163 0.72
164 0.67
165 0.63
166 0.62
167 0.59
168 0.64
169 0.57
170 0.48
171 0.43
172 0.42
173 0.39
174 0.38
175 0.4
176 0.34
177 0.36
178 0.38
179 0.37
180 0.39
181 0.4
182 0.39
183 0.35
184 0.34
185 0.32
186 0.36
187 0.39
188 0.36
189 0.34
190 0.34
191 0.37
192 0.44
193 0.52
194 0.54
195 0.59
196 0.68
197 0.77
198 0.78
199 0.77
200 0.73
201 0.7
202 0.68
203 0.59
204 0.55
205 0.45
206 0.41
207 0.41
208 0.35