Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VN68

Protein Details
Accession A0A0M9VN68   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VNIPKTRRTYCKGKACRKHTPHKVTQYKAHydrophilic
NLS Segment(s)
PositionSequence
41-48RRYVRKQK
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKACRKHTPHKVTQYKAGKASDFAQGKRRYVRKQKGYGGQTKPVFQKKAKTTKKVVLRLECTVCKYRHHLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.86
6 0.87
7 0.87
8 0.86
9 0.85
10 0.85
11 0.86
12 0.79
13 0.8
14 0.77
15 0.7
16 0.66
17 0.58
18 0.48
19 0.41
20 0.39
21 0.37
22 0.32
23 0.29
24 0.33
25 0.34
26 0.36
27 0.42
28 0.47
29 0.48
30 0.55
31 0.64
32 0.64
33 0.69
34 0.73
35 0.73
36 0.73
37 0.73
38 0.65
39 0.62
40 0.54
41 0.5
42 0.49
43 0.46
44 0.44
45 0.37
46 0.42
47 0.43
48 0.53
49 0.57
50 0.58
51 0.58
52 0.62
53 0.69
54 0.69
55 0.67
56 0.63
57 0.6
58 0.59
59 0.58
60 0.52
61 0.48
62 0.46
63 0.4
64 0.37
65 0.38
66 0.38
67 0.42
68 0.49
69 0.51
70 0.55
71 0.65
72 0.71
73 0.74
74 0.72
75 0.65
76 0.6
77 0.55
78 0.52
79 0.52
80 0.51
81 0.51
82 0.53
83 0.51
84 0.49
85 0.48
86 0.42