Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M9VQ20

Protein Details
Accession A0A0M9VQ20    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
264-294VGDVAWSRRRRRNRGGDRKRRDRPQDYEEDYBasic
NLS Segment(s)
PositionSequence
271-286RRRRRNRGGDRKRRDR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019416  NCBP3  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0000340  F:RNA 7-methylguanosine cap binding  
Pfam View protein in Pfam  
PF10309  NCBP3  
Amino Acid Sequences MDSALTDVPMEGEEAPKRIFYNMPDEMVGAEEDIEEEELPPAPIKEKPDTGVPPPAPSVDAHDALRVDALHLEGEPINQLSTSRLMAYVAYSGTHAKGIEWINDTRCVIVFDSYEHALQGLERLCYDPWEETRFPEDVANENKDVLLRPCLAMAFPTKLYNAMEQETASELPALQSQLDEARAKLESAAEPMPEIYRDMEMEEMERKIFSRDHRRMKQLRQPLWVRFALQHHDTKSPRSASKSNWYRQHGRGAGKEVVTRLLDVGDVAWSRRRRRNRGGDRKRRDRPQDYEEDYTPLSLRDRIGGVRRDRDWDDDDAGRLVRDRSASPDRGSDVRIRGRGSAYAPRSRGWDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.2
5 0.21
6 0.23
7 0.22
8 0.29
9 0.29
10 0.3
11 0.29
12 0.28
13 0.26
14 0.24
15 0.21
16 0.12
17 0.09
18 0.07
19 0.07
20 0.07
21 0.07
22 0.06
23 0.07
24 0.07
25 0.08
26 0.09
27 0.09
28 0.1
29 0.11
30 0.14
31 0.19
32 0.24
33 0.26
34 0.27
35 0.34
36 0.38
37 0.4
38 0.46
39 0.42
40 0.39
41 0.37
42 0.36
43 0.29
44 0.25
45 0.29
46 0.24
47 0.25
48 0.23
49 0.24
50 0.23
51 0.22
52 0.23
53 0.15
54 0.11
55 0.1
56 0.1
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.09
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.1
69 0.11
70 0.1
71 0.1
72 0.1
73 0.1
74 0.1
75 0.1
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.1
82 0.1
83 0.08
84 0.14
85 0.15
86 0.17
87 0.19
88 0.21
89 0.22
90 0.25
91 0.25
92 0.2
93 0.19
94 0.17
95 0.15
96 0.14
97 0.12
98 0.11
99 0.14
100 0.14
101 0.14
102 0.12
103 0.11
104 0.09
105 0.09
106 0.11
107 0.1
108 0.09
109 0.09
110 0.11
111 0.11
112 0.12
113 0.13
114 0.12
115 0.13
116 0.19
117 0.19
118 0.19
119 0.22
120 0.22
121 0.21
122 0.21
123 0.19
124 0.18
125 0.22
126 0.23
127 0.2
128 0.2
129 0.19
130 0.18
131 0.18
132 0.14
133 0.13
134 0.11
135 0.11
136 0.11
137 0.11
138 0.1
139 0.1
140 0.11
141 0.1
142 0.1
143 0.11
144 0.11
145 0.12
146 0.13
147 0.14
148 0.13
149 0.12
150 0.12
151 0.11
152 0.11
153 0.11
154 0.11
155 0.09
156 0.07
157 0.06
158 0.06
159 0.07
160 0.07
161 0.05
162 0.05
163 0.05
164 0.06
165 0.08
166 0.08
167 0.07
168 0.08
169 0.08
170 0.09
171 0.08
172 0.09
173 0.07
174 0.09
175 0.1
176 0.09
177 0.08
178 0.09
179 0.09
180 0.08
181 0.08
182 0.06
183 0.06
184 0.07
185 0.07
186 0.07
187 0.07
188 0.08
189 0.09
190 0.09
191 0.09
192 0.08
193 0.08
194 0.1
195 0.13
196 0.19
197 0.28
198 0.37
199 0.47
200 0.53
201 0.63
202 0.68
203 0.74
204 0.75
205 0.74
206 0.71
207 0.69
208 0.68
209 0.62
210 0.6
211 0.52
212 0.45
213 0.39
214 0.36
215 0.33
216 0.31
217 0.32
218 0.29
219 0.35
220 0.35
221 0.35
222 0.38
223 0.38
224 0.37
225 0.39
226 0.41
227 0.39
228 0.49
229 0.54
230 0.56
231 0.6
232 0.63
233 0.63
234 0.63
235 0.67
236 0.62
237 0.58
238 0.54
239 0.52
240 0.49
241 0.43
242 0.42
243 0.33
244 0.3
245 0.25
246 0.22
247 0.16
248 0.12
249 0.11
250 0.09
251 0.08
252 0.08
253 0.08
254 0.09
255 0.15
256 0.21
257 0.29
258 0.38
259 0.48
260 0.54
261 0.65
262 0.75
263 0.8
264 0.86
265 0.9
266 0.93
267 0.93
268 0.95
269 0.94
270 0.92
271 0.91
272 0.89
273 0.85
274 0.82
275 0.82
276 0.77
277 0.73
278 0.64
279 0.57
280 0.48
281 0.41
282 0.33
283 0.24
284 0.2
285 0.17
286 0.16
287 0.15
288 0.17
289 0.21
290 0.28
291 0.34
292 0.39
293 0.44
294 0.45
295 0.48
296 0.49
297 0.5
298 0.46
299 0.42
300 0.4
301 0.35
302 0.35
303 0.31
304 0.29
305 0.24
306 0.22
307 0.19
308 0.17
309 0.18
310 0.17
311 0.23
312 0.31
313 0.35
314 0.36
315 0.39
316 0.4
317 0.4
318 0.42
319 0.41
320 0.41
321 0.45
322 0.47
323 0.44
324 0.44
325 0.44
326 0.44
327 0.42
328 0.44
329 0.43
330 0.47
331 0.47
332 0.45