Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8MNF7

Protein Details
Accession A0A0M8MNF7    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-30KVTTGARRTKSKKDPAAPKRPLSHydrophilic
NLS Segment(s)
PositionSequence
14-26RRTKSKKDPAAPK
Subcellular Location(s) nucl 20, cyto 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKQPTQKVTTGARRTKSKKDPAAPKRPLSAYMFFSQDWRERVKAENPDAGFGDVGRLLGTKWKEMSDEEKKPYIEMANKDKERAEKEKAEYAQNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.75
4 0.76
5 0.76
6 0.76
7 0.78
8 0.82
9 0.83
10 0.87
11 0.84
12 0.78
13 0.73
14 0.65
15 0.59
16 0.53
17 0.46
18 0.39
19 0.34
20 0.32
21 0.27
22 0.27
23 0.26
24 0.24
25 0.23
26 0.22
27 0.21
28 0.2
29 0.23
30 0.28
31 0.31
32 0.3
33 0.33
34 0.3
35 0.3
36 0.29
37 0.26
38 0.2
39 0.13
40 0.11
41 0.06
42 0.06
43 0.05
44 0.04
45 0.04
46 0.09
47 0.1
48 0.11
49 0.12
50 0.13
51 0.14
52 0.16
53 0.25
54 0.29
55 0.35
56 0.37
57 0.4
58 0.4
59 0.39
60 0.39
61 0.36
62 0.33
63 0.33
64 0.38
65 0.44
66 0.45
67 0.46
68 0.48
69 0.49
70 0.5
71 0.5
72 0.48
73 0.46
74 0.5
75 0.57
76 0.56
77 0.6