Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8MVS7

Protein Details
Accession A0A0M8MVS7    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MPREPKPRERPSPHKKAEEPKKKKKFAETQGLGBasic
91-119MALLRERRRERSRERKKKRKQLPDDAEEDBasic
NLS Segment(s)
PositionSequence
4-25EPKPRERPSPHKKAEEPKKKKK
95-110RERRRERSRERKKKRK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MPREPKPRERPSPHKKAEEPKKKKKFAETQGLGHILALSEQAVQKKNAHFQKLLDKEHASRASAAAARKERTLKKEAAKNDSDLPTRQSMMALLRERRRERSRERKKKRKQLPDDAEEDAVPHAPTAPRSSKAQGSILKKDTAKAPTKKRVSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.85
4 0.86
5 0.87
6 0.87
7 0.87
8 0.89
9 0.88
10 0.86
11 0.85
12 0.85
13 0.83
14 0.83
15 0.77
16 0.7
17 0.67
18 0.63
19 0.52
20 0.41
21 0.32
22 0.2
23 0.15
24 0.11
25 0.06
26 0.06
27 0.08
28 0.11
29 0.13
30 0.15
31 0.19
32 0.22
33 0.3
34 0.35
35 0.37
36 0.35
37 0.36
38 0.44
39 0.48
40 0.47
41 0.43
42 0.39
43 0.36
44 0.42
45 0.41
46 0.32
47 0.25
48 0.22
49 0.21
50 0.21
51 0.21
52 0.19
53 0.21
54 0.21
55 0.23
56 0.29
57 0.31
58 0.33
59 0.36
60 0.36
61 0.38
62 0.43
63 0.45
64 0.45
65 0.43
66 0.4
67 0.4
68 0.37
69 0.33
70 0.28
71 0.26
72 0.22
73 0.21
74 0.19
75 0.15
76 0.12
77 0.13
78 0.18
79 0.19
80 0.24
81 0.28
82 0.36
83 0.39
84 0.46
85 0.5
86 0.52
87 0.59
88 0.65
89 0.72
90 0.75
91 0.84
92 0.87
93 0.91
94 0.94
95 0.94
96 0.94
97 0.92
98 0.92
99 0.9
100 0.85
101 0.78
102 0.7
103 0.6
104 0.49
105 0.39
106 0.28
107 0.2
108 0.14
109 0.1
110 0.09
111 0.09
112 0.12
113 0.17
114 0.21
115 0.23
116 0.27
117 0.31
118 0.34
119 0.36
120 0.41
121 0.43
122 0.45
123 0.51
124 0.51
125 0.52
126 0.48
127 0.47
128 0.47
129 0.48
130 0.51
131 0.52
132 0.58
133 0.63
134 0.72