Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M9VMW8

Protein Details
Accession A0A0M9VMW8    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
96-123RSELRSESNQKKRQRRRELLKAKKRASDBasic
NLS Segment(s)
PositionSequence
106-120KKRQRRRELLKAKKR
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
Amino Acid Sequences MPRKRAKLSARQAQRDALGHDLAPEPKNHRGVWGDTPRRAMELFRGPPPKRRTEEETSKARASSTPQLQIKPGERIKDFNQRVEQAFASDINATMRSELRSESNQKKRQRRRELLKAKKRASDPFAAQAAEAASDFRQATQSKSLHDVAQAPPTITAIPKERLKRKASSTTPTPLAALDAQAAARPKPSAARQRILDEERQRVIQQYRAMKHRTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.57
3 0.5
4 0.43
5 0.34
6 0.26
7 0.25
8 0.25
9 0.25
10 0.23
11 0.24
12 0.25
13 0.31
14 0.35
15 0.33
16 0.34
17 0.34
18 0.37
19 0.44
20 0.49
21 0.5
22 0.49
23 0.53
24 0.49
25 0.47
26 0.43
27 0.34
28 0.3
29 0.32
30 0.33
31 0.36
32 0.45
33 0.45
34 0.54
35 0.59
36 0.61
37 0.56
38 0.58
39 0.59
40 0.59
41 0.67
42 0.66
43 0.67
44 0.64
45 0.6
46 0.54
47 0.47
48 0.39
49 0.34
50 0.35
51 0.32
52 0.35
53 0.37
54 0.38
55 0.39
56 0.42
57 0.4
58 0.4
59 0.38
60 0.35
61 0.33
62 0.36
63 0.39
64 0.45
65 0.44
66 0.41
67 0.42
68 0.4
69 0.41
70 0.39
71 0.34
72 0.24
73 0.22
74 0.17
75 0.13
76 0.11
77 0.09
78 0.08
79 0.08
80 0.07
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.11
87 0.14
88 0.21
89 0.3
90 0.4
91 0.47
92 0.55
93 0.64
94 0.72
95 0.79
96 0.83
97 0.83
98 0.82
99 0.86
100 0.89
101 0.89
102 0.89
103 0.88
104 0.81
105 0.76
106 0.7
107 0.64
108 0.58
109 0.52
110 0.44
111 0.39
112 0.37
113 0.31
114 0.27
115 0.23
116 0.18
117 0.13
118 0.11
119 0.07
120 0.05
121 0.07
122 0.07
123 0.07
124 0.11
125 0.11
126 0.14
127 0.21
128 0.22
129 0.22
130 0.26
131 0.27
132 0.24
133 0.25
134 0.26
135 0.2
136 0.24
137 0.23
138 0.19
139 0.18
140 0.18
141 0.17
142 0.14
143 0.15
144 0.14
145 0.19
146 0.25
147 0.33
148 0.41
149 0.48
150 0.53
151 0.56
152 0.59
153 0.64
154 0.64
155 0.63
156 0.61
157 0.6
158 0.57
159 0.52
160 0.44
161 0.34
162 0.3
163 0.23
164 0.18
165 0.12
166 0.1
167 0.09
168 0.11
169 0.13
170 0.11
171 0.12
172 0.12
173 0.12
174 0.18
175 0.27
176 0.35
177 0.41
178 0.48
179 0.5
180 0.55
181 0.63
182 0.61
183 0.61
184 0.58
185 0.57
186 0.53
187 0.52
188 0.47
189 0.46
190 0.45
191 0.42
192 0.43
193 0.45
194 0.49
195 0.54