Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M9VQ31

Protein Details
Accession A0A0M9VQ31    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-40ASEEVRLKKEKKEKKEKKEKKEKKEKKEKKKDDVMTEDLBasic
NLS Segment(s)
PositionSequence
7-32RLKKEKKEKKEKKEKKEKKEKKEKKK
76-106KVFKTIKKASKSRGHVKRGVKEVVKGLRKGE
Subcellular Location(s) nucl 22.5, mito_nucl 12.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MASEEVRLKKEKKEKKEKKEKKEKKEKKEKKKDDVMTEDLVGDVSMAEPVDDDAEVDPSTLNVIACPLATPPFTKKVFKTIKKASKSRGHVKRGVKEVVKGLRKGEKGLVILAGDISPMDIISHIPVLCEDTGNPYVFVASKDQLGNASSTKRPTSCVMIVPGGGKKAIEKGETKVKEDYQEEYSSLHKEATRLVEQLLMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.92
4 0.93
5 0.94
6 0.96
7 0.95
8 0.95
9 0.96
10 0.95
11 0.95
12 0.96
13 0.95
14 0.95
15 0.96
16 0.95
17 0.94
18 0.94
19 0.9
20 0.87
21 0.84
22 0.77
23 0.68
24 0.58
25 0.47
26 0.36
27 0.28
28 0.19
29 0.12
30 0.07
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.05
41 0.07
42 0.07
43 0.07
44 0.06
45 0.06
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.07
57 0.09
58 0.12
59 0.19
60 0.22
61 0.25
62 0.25
63 0.34
64 0.43
65 0.47
66 0.53
67 0.56
68 0.63
69 0.67
70 0.71
71 0.69
72 0.68
73 0.7
74 0.71
75 0.7
76 0.67
77 0.67
78 0.69
79 0.67
80 0.63
81 0.61
82 0.52
83 0.44
84 0.43
85 0.43
86 0.4
87 0.34
88 0.31
89 0.32
90 0.32
91 0.31
92 0.28
93 0.23
94 0.2
95 0.19
96 0.18
97 0.11
98 0.11
99 0.1
100 0.07
101 0.05
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.06
111 0.06
112 0.06
113 0.06
114 0.08
115 0.08
116 0.08
117 0.08
118 0.11
119 0.14
120 0.14
121 0.14
122 0.12
123 0.12
124 0.13
125 0.14
126 0.12
127 0.1
128 0.12
129 0.12
130 0.13
131 0.13
132 0.14
133 0.14
134 0.13
135 0.16
136 0.16
137 0.19
138 0.22
139 0.22
140 0.24
141 0.25
142 0.3
143 0.28
144 0.29
145 0.29
146 0.27
147 0.28
148 0.27
149 0.26
150 0.2
151 0.18
152 0.15
153 0.13
154 0.17
155 0.19
156 0.2
157 0.21
158 0.25
159 0.35
160 0.37
161 0.4
162 0.4
163 0.39
164 0.42
165 0.42
166 0.41
167 0.35
168 0.35
169 0.32
170 0.29
171 0.29
172 0.25
173 0.24
174 0.23
175 0.19
176 0.18
177 0.22
178 0.28
179 0.29
180 0.27
181 0.27