Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VPZ5

Protein Details
Accession A0A0M9VPZ5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-134LAPKIEKPSRKLRKERKNRAKKVRGTKKSKTGDAKKKBasic
NLS Segment(s)
PositionSequence
90-134KHRLVRNGLAPKIEKPSRKLRKERKNRAKKVRGTKKSKTGDAKKK
Subcellular Location(s) mito 18.5, mito_nucl 13.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MDLNSPITLRTRKFITNRLLQRKQMVLDVIHPARPNVSRAELQEKLGELYKSPKEQVFVFGMRTHYGGGRSTGFALIYDSKEALERFEPKHRLVRNGLAPKIEKPSRKLRKERKNRAKKVRGTKKSKTGDAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.55
4 0.64
5 0.7
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.33
16 0.29
17 0.28
18 0.26
19 0.23
20 0.24
21 0.24
22 0.23
23 0.19
24 0.21
25 0.21
26 0.24
27 0.31
28 0.29
29 0.29
30 0.28
31 0.26
32 0.23
33 0.23
34 0.2
35 0.14
36 0.18
37 0.2
38 0.2
39 0.21
40 0.21
41 0.2
42 0.2
43 0.23
44 0.21
45 0.18
46 0.18
47 0.18
48 0.18
49 0.17
50 0.17
51 0.14
52 0.11
53 0.11
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.1
69 0.1
70 0.1
71 0.12
72 0.15
73 0.18
74 0.26
75 0.3
76 0.31
77 0.39
78 0.39
79 0.42
80 0.42
81 0.46
82 0.47
83 0.51
84 0.5
85 0.46
86 0.45
87 0.42
88 0.47
89 0.45
90 0.4
91 0.38
92 0.48
93 0.55
94 0.63
95 0.71
96 0.74
97 0.79
98 0.87
99 0.93
100 0.93
101 0.94
102 0.95
103 0.95
104 0.95
105 0.93
106 0.93
107 0.93
108 0.93
109 0.91
110 0.9
111 0.89
112 0.87
113 0.86
114 0.85