Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VQ83

Protein Details
Accession A0A0M9VQ83   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-93ELIRNSKDKRARKFIKRRIGTLRRBasic
NLS Segment(s)
PositionSequence
74-97NSKDKRARKFIKRRIGTLRRAKRK
Subcellular Location(s) cyto 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MGSSSNPAHKAGVPRTGLVWGINRGHPTTRRVLAPRPVSKKAVAGERVTTIRSVVREVAGFAPYERRAMELIRNSKDKRARKFIKRRIGTLRRAKRKMEILTGVIAEQRRSGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.33
4 0.3
5 0.24
6 0.23
7 0.2
8 0.21
9 0.23
10 0.24
11 0.24
12 0.28
13 0.3
14 0.31
15 0.32
16 0.33
17 0.35
18 0.37
19 0.42
20 0.45
21 0.51
22 0.56
23 0.56
24 0.57
25 0.54
26 0.52
27 0.49
28 0.43
29 0.41
30 0.35
31 0.3
32 0.27
33 0.27
34 0.27
35 0.24
36 0.21
37 0.15
38 0.13
39 0.12
40 0.12
41 0.1
42 0.1
43 0.09
44 0.1
45 0.1
46 0.09
47 0.09
48 0.08
49 0.11
50 0.11
51 0.12
52 0.11
53 0.11
54 0.11
55 0.12
56 0.18
57 0.21
58 0.28
59 0.31
60 0.37
61 0.37
62 0.44
63 0.51
64 0.54
65 0.55
66 0.59
67 0.65
68 0.7
69 0.8
70 0.83
71 0.85
72 0.82
73 0.8
74 0.8
75 0.8
76 0.79
77 0.78
78 0.79
79 0.79
80 0.8
81 0.76
82 0.73
83 0.73
84 0.68
85 0.65
86 0.59
87 0.51
88 0.48
89 0.45
90 0.38
91 0.33
92 0.28
93 0.21