FuNGI

A0A0M8MSC8

Protein Details

Accession

A0A0M8MSC8

Localization Confidence

High

Confidence Score

19.8

NoLS Segment(s)

Position	Sequence	Protein Nature
12-42	RATDPRLRVPKPKWTKQRPRRHLDSVQYKYD	Hydrophilic
149-168	GERYERQREERRKARDRAAA	Basic
177-200	RARSSSWRTTPRRPSPPRAPMPSV	Hydrophilic

NLS Segment(s)

Position	Sequence
17-32	RLRVPKPKWTKQRPRR
160-162	RKA

Subcellular Location(s)

nucl 12, cyto 7, mito 6

Family & Domain DBs

InterPro	View protein in InterPro IPR024657 COMPASS_Set1_N-SET IPR012677 Nucleotide-bd_a/b_plait_sf IPR003616 Post-SET_dom IPR035979 RBD_domain_sf IPR044570 Set1-like IPR001214 SET_dom IPR046341 SET_dom_sf
Gene Ontology	GO:0005694 C:chromosome GO:0140999 F:histone H3K4 trimethyltransferase activity GO:0003676 F:nucleic acid binding GO:0051568 P:histone H3-K4 methylation
Pfam	View protein in Pfam PF00856 SET
PROSITE	View protein in PROSITE PS50868 POST_SET PS50280 SET
CDD	cd12303 RRM_spSet1p_like

Amino Acid Sequences

MRRRYEVEPRLRATDPRLRVPKPKWTKQRPRRHLDSVQYKYDSHSVGPPPPHEIVITGLSPLTTPAQVLQHCRGFGAIDASELKVDPQTGQSIGIMWISFGPQGTTDPADAAKTARASLHGTKIGTETVRVMTDHDRATYVRQYRQLLGERYERQREERRKARDRAAAQANAEAQERARSSSWRTTPRRPSPPRAPMPSVVRRLAALGHDYVFIPRVQAKAIDTEAIREHVAPFQPALVDRDEAGWYIGFDRADAAGRCRMVLGPGTLQGYSLRMDVRPAPRVSERAARTEKMRGPASKPVSTPAPRPRSKDELLDQASATLVRDLTAMLARDIKTRMITPLVTQFLRPDAPGGLRLAQYKADAMARAPATLATKAASRQLDSIPLRPGASIPVKKATPKRSASATPQADGPTPTVATADSSSGAATPVPAESTEPIDPIAHGIVQDAEEAMYLTQLLAREACGEEPVGDTPTSAHDAGSARAQGYYRIPASEKAAHVPDRNRAVAGNEASSALALASARNTRADSRRLALDLEQHRRETLAATDLLNINQLQARKKQLRFAKSPIHDWGLYAMELIPAGDMVIEYVGEIVRQQVADHREKMYERAGNFSTYLFRVDDDVVVDATHKGNIARLMNHCCTPNCTAKILTVQGEKRIVLFAKQAILPGQELTYDYKFQATGDEEDAIPCLCGSPACRRFL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.58
2	0.53
3	0.55
4	0.6
5	0.59
6	0.66
7	0.69
8	0.72
9	0.73
10	0.78
11	0.79
12	0.81
13	0.88
14	0.89
15	0.94
16	0.94
17	0.93
18	0.91
19	0.9
20	0.87
21	0.87
22	0.87
23	0.82
24	0.8
25	0.73
26	0.64
27	0.58
28	0.54
29	0.44
30	0.35
31	0.36
32	0.33
33	0.36
34	0.41
35	0.39
36	0.4
37	0.39
38	0.38
39	0.31
40	0.27
41	0.24
42	0.22
43	0.21
44	0.16
45	0.14
46	0.13
47	0.13
48	0.13
49	0.12
50	0.09
51	0.09
52	0.11
53	0.17
54	0.2
55	0.26
56	0.32
57	0.34
58	0.33
59	0.33
60	0.31
61	0.25
62	0.24
63	0.23
64	0.16
65	0.14
66	0.16
67	0.16
68	0.16
69	0.15
70	0.15
71	0.11
72	0.12
73	0.11
74	0.12
75	0.14
76	0.14
77	0.15
78	0.14
79	0.14
80	0.14
81	0.14
82	0.11
83	0.09
84	0.09
85	0.09
86	0.09
87	0.08
88	0.08
89	0.08
90	0.09
91	0.12
92	0.13
93	0.12
94	0.13
95	0.13
96	0.13
97	0.13
98	0.13
99	0.13
100	0.13
101	0.13
102	0.13
103	0.15
104	0.19
105	0.23
106	0.28
107	0.29
108	0.28
109	0.29
110	0.29
111	0.3
112	0.25
113	0.22
114	0.17
115	0.15
116	0.17
117	0.16
118	0.17
119	0.18
120	0.22
121	0.22
122	0.21
123	0.21
124	0.2
125	0.25
126	0.3
127	0.31
128	0.32
129	0.37
130	0.4
131	0.41
132	0.47
133	0.5
134	0.46
135	0.45
136	0.48
137	0.49
138	0.52
139	0.57
140	0.52
141	0.52
142	0.59
143	0.64
144	0.66
145	0.68
146	0.72
147	0.74
148	0.79
149	0.8
150	0.79
151	0.72
152	0.71
153	0.7
154	0.63
155	0.54
156	0.5
157	0.42
158	0.35
159	0.33
160	0.24
161	0.16
162	0.17
163	0.16
164	0.16
165	0.17
166	0.18
167	0.22
168	0.31
169	0.38
170	0.44
171	0.5
172	0.57
173	0.66
174	0.74
175	0.8
176	0.78
177	0.81
178	0.81
179	0.85
180	0.84
181	0.8
182	0.74
183	0.69
184	0.7
185	0.69
186	0.64
187	0.55
188	0.47
189	0.39
190	0.36
191	0.31
192	0.23
193	0.17
194	0.13
195	0.12
196	0.12
197	0.12
198	0.12
199	0.12
200	0.1
201	0.1
202	0.1
203	0.1
204	0.1
205	0.12
206	0.12
207	0.14
208	0.14
209	0.16
210	0.13
211	0.15
212	0.15
213	0.16
214	0.15
215	0.13
216	0.13
217	0.14
218	0.15
219	0.13
220	0.12
221	0.11
222	0.11
223	0.12
224	0.13
225	0.11
226	0.11
227	0.1
228	0.12
229	0.11
230	0.11
231	0.11
232	0.09
233	0.07
234	0.08
235	0.09
236	0.08
237	0.07
238	0.08
239	0.08
240	0.11
241	0.11
242	0.12
243	0.14
244	0.14
245	0.14
246	0.14
247	0.13
248	0.12
249	0.13
250	0.12
251	0.09
252	0.11
253	0.12
254	0.12
255	0.12
256	0.11
257	0.1
258	0.1
259	0.1
260	0.09
261	0.08
262	0.1
263	0.15
264	0.19
265	0.23
266	0.23
267	0.25
268	0.27
269	0.29
270	0.3
271	0.33
272	0.3
273	0.32
274	0.35
275	0.33
276	0.33
277	0.39
278	0.39
279	0.37
280	0.39
281	0.34
282	0.34
283	0.41
284	0.44
285	0.4
286	0.37
287	0.34
288	0.36
289	0.36
290	0.4
291	0.41
292	0.45
293	0.46
294	0.5
295	0.53
296	0.53
297	0.53
298	0.52
299	0.45
300	0.44
301	0.43
302	0.4
303	0.34
304	0.27
305	0.25
306	0.19
307	0.17
308	0.08
309	0.05
310	0.04
311	0.05
312	0.04
313	0.05
314	0.06
315	0.06
316	0.06
317	0.09
318	0.1
319	0.12
320	0.13
321	0.13
322	0.12
323	0.13
324	0.13
325	0.12
326	0.12
327	0.11
328	0.15
329	0.17
330	0.16
331	0.16
332	0.15
333	0.15
334	0.15
335	0.14
336	0.1
337	0.08
338	0.08
339	0.1
340	0.1
341	0.1
342	0.11
343	0.12
344	0.12
345	0.12
346	0.11
347	0.1
348	0.1
349	0.09
350	0.08
351	0.07
352	0.11
353	0.1
354	0.1
355	0.1
356	0.1
357	0.11
358	0.11
359	0.11
360	0.07
361	0.08
362	0.09
363	0.13
364	0.13
365	0.12
366	0.14
367	0.14
368	0.21
369	0.21
370	0.24
371	0.21
372	0.22
373	0.21
374	0.19
375	0.19
376	0.16
377	0.21
378	0.2
379	0.2
380	0.23
381	0.24
382	0.29
383	0.36
384	0.38
385	0.41
386	0.42
387	0.42
388	0.43
389	0.46
390	0.47
391	0.5
392	0.44
393	0.36
394	0.35
395	0.33
396	0.3
397	0.27
398	0.21
399	0.13
400	0.11
401	0.1
402	0.09
403	0.08
404	0.08
405	0.08
406	0.07
407	0.07
408	0.07
409	0.07
410	0.06
411	0.07
412	0.05
413	0.05
414	0.05
415	0.04
416	0.05
417	0.05
418	0.05
419	0.06
420	0.1
421	0.1
422	0.1
423	0.1
424	0.1
425	0.1
426	0.1
427	0.1
428	0.06
429	0.06
430	0.06
431	0.06
432	0.06
433	0.06
434	0.05
435	0.05
436	0.04
437	0.05
438	0.04
439	0.04
440	0.03
441	0.03
442	0.05
443	0.05
444	0.05
445	0.05
446	0.06
447	0.07
448	0.08
449	0.08
450	0.07
451	0.07
452	0.07
453	0.08
454	0.09
455	0.09
456	0.09
457	0.08
458	0.08
459	0.1
460	0.13
461	0.12
462	0.11
463	0.12
464	0.13
465	0.14
466	0.15
467	0.14
468	0.12
469	0.13
470	0.13
471	0.13
472	0.14
473	0.17
474	0.16
475	0.16
476	0.17
477	0.18
478	0.23
479	0.26
480	0.25
481	0.24
482	0.27
483	0.29
484	0.33
485	0.34
486	0.36
487	0.36
488	0.36
489	0.33
490	0.29
491	0.28
492	0.28
493	0.27
494	0.21
495	0.16
496	0.16
497	0.15
498	0.14
499	0.12
500	0.06
501	0.06
502	0.05
503	0.04
504	0.07
505	0.09
506	0.1
507	0.11
508	0.13
509	0.18
510	0.23
511	0.27
512	0.28
513	0.29
514	0.31
515	0.31
516	0.31
517	0.27
518	0.31
519	0.35
520	0.4
521	0.4
522	0.38
523	0.37
524	0.36
525	0.35
526	0.28
527	0.21
528	0.16
529	0.15
530	0.15
531	0.17
532	0.17
533	0.17
534	0.17
535	0.15
536	0.12
537	0.13
538	0.16
539	0.17
540	0.22
541	0.31
542	0.39
543	0.41
544	0.49
545	0.54
546	0.6
547	0.62
548	0.65
549	0.65
550	0.6
551	0.63
552	0.6
553	0.56
554	0.48
555	0.42
556	0.37
557	0.28
558	0.24
559	0.2
560	0.15
561	0.1
562	0.1
563	0.09
564	0.06
565	0.04
566	0.04
567	0.04
568	0.03
569	0.03
570	0.03
571	0.03
572	0.03
573	0.04
574	0.04
575	0.04
576	0.04
577	0.05
578	0.07
579	0.07
580	0.08
581	0.13
582	0.2
583	0.26
584	0.29
585	0.3
586	0.33
587	0.34
588	0.38
589	0.39
590	0.37
591	0.32
592	0.35
593	0.34
594	0.32
595	0.31
596	0.29
597	0.25
598	0.21
599	0.23
600	0.17
601	0.16
602	0.16
603	0.17
604	0.17
605	0.15
606	0.15
607	0.13
608	0.12
609	0.13
610	0.11
611	0.11
612	0.11
613	0.1
614	0.1
615	0.12
616	0.18
617	0.2
618	0.24
619	0.29
620	0.36
621	0.39
622	0.41
623	0.42
624	0.38
625	0.4
626	0.41
627	0.44
628	0.39
629	0.39
630	0.37
631	0.37
632	0.41
633	0.4
634	0.39
635	0.38
636	0.38
637	0.41
638	0.43
639	0.4
640	0.35
641	0.35
642	0.31
643	0.26
644	0.27
645	0.24
646	0.25
647	0.26
648	0.26
649	0.24
650	0.24
651	0.23
652	0.2
653	0.17
654	0.14
655	0.15
656	0.19
657	0.2
658	0.2
659	0.2
660	0.2
661	0.2
662	0.19
663	0.23
664	0.22
665	0.22
666	0.22
667	0.24
668	0.22
669	0.22
670	0.23
671	0.18
672	0.15
673	0.11
674	0.09
675	0.08
676	0.09
677	0.13
678	0.23

A0A0M8MSC8

3D AlphaFold-predicted Structure Viewer