Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8MJT7

Protein Details
Accession A0A0M8MJT7   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-111MARSASPADSRKKRNRRKGERADAGNTHydrophilic
NLS Segment(s)
PositionSequence
94-105SRKKRNRRKGER
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025762  DFDF  
IPR019050  FDF_dom  
PROSITE View protein in PROSITE  
PS51512  DFDF  
Amino Acid Sequences MASFVGTTVRLTLRSGDSYVGTILSIDPATATLKVQRTDNGEMIAVRREELQDVSTVTETSQSSSAPSNSVSTPKQSHKALADPMARSASPADSRKKRNRRKGERADAGNTTTAPAGPASMFDEEFDFTKSTQNFDKKKIWEEIRNQEANPNPHLLVNINRNPLLQQSAGSKQPMLAPTEMVLDEPSEPIAAPTSNLGEVQVLRSEVDTLSGALAEARSEIQRLRSQVALSEALTGLHIEDLGDGTYVCGVYKDAKTSAAHWRHKHQQSEPVGTDGALRYLVRAPGIGNTDAVSLGYGGPHRDHSDAEVLEKLPDHFQSDINIKLDNAPLFQRRLTDLMQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.22
5 0.22
6 0.21
7 0.17
8 0.13
9 0.11
10 0.1
11 0.1
12 0.09
13 0.07
14 0.07
15 0.08
16 0.1
17 0.1
18 0.11
19 0.15
20 0.2
21 0.22
22 0.24
23 0.27
24 0.32
25 0.36
26 0.37
27 0.32
28 0.28
29 0.28
30 0.27
31 0.28
32 0.22
33 0.17
34 0.17
35 0.17
36 0.17
37 0.18
38 0.17
39 0.14
40 0.14
41 0.16
42 0.15
43 0.14
44 0.12
45 0.15
46 0.14
47 0.14
48 0.14
49 0.12
50 0.14
51 0.16
52 0.17
53 0.14
54 0.15
55 0.16
56 0.16
57 0.21
58 0.21
59 0.24
60 0.29
61 0.33
62 0.39
63 0.38
64 0.41
65 0.39
66 0.43
67 0.41
68 0.43
69 0.42
70 0.36
71 0.37
72 0.34
73 0.31
74 0.26
75 0.24
76 0.2
77 0.21
78 0.26
79 0.33
80 0.39
81 0.5
82 0.6
83 0.7
84 0.77
85 0.82
86 0.87
87 0.89
88 0.92
89 0.93
90 0.93
91 0.91
92 0.85
93 0.79
94 0.69
95 0.6
96 0.5
97 0.38
98 0.28
99 0.2
100 0.14
101 0.1
102 0.08
103 0.07
104 0.06
105 0.06
106 0.08
107 0.09
108 0.09
109 0.08
110 0.09
111 0.09
112 0.1
113 0.11
114 0.1
115 0.09
116 0.14
117 0.14
118 0.16
119 0.22
120 0.3
121 0.32
122 0.37
123 0.44
124 0.41
125 0.46
126 0.51
127 0.5
128 0.49
129 0.53
130 0.56
131 0.56
132 0.55
133 0.5
134 0.47
135 0.46
136 0.41
137 0.35
138 0.28
139 0.21
140 0.2
141 0.2
142 0.17
143 0.17
144 0.22
145 0.24
146 0.24
147 0.24
148 0.23
149 0.23
150 0.23
151 0.21
152 0.14
153 0.11
154 0.12
155 0.14
156 0.16
157 0.16
158 0.15
159 0.13
160 0.16
161 0.16
162 0.15
163 0.13
164 0.11
165 0.11
166 0.13
167 0.12
168 0.09
169 0.08
170 0.06
171 0.06
172 0.06
173 0.06
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.08
193 0.07
194 0.08
195 0.07
196 0.06
197 0.06
198 0.06
199 0.05
200 0.05
201 0.05
202 0.04
203 0.04
204 0.05
205 0.05
206 0.06
207 0.07
208 0.11
209 0.15
210 0.17
211 0.18
212 0.19
213 0.19
214 0.2
215 0.22
216 0.19
217 0.16
218 0.16
219 0.14
220 0.12
221 0.12
222 0.1
223 0.07
224 0.05
225 0.05
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.05
234 0.05
235 0.05
236 0.04
237 0.05
238 0.09
239 0.11
240 0.14
241 0.14
242 0.17
243 0.18
244 0.21
245 0.31
246 0.37
247 0.44
248 0.45
249 0.52
250 0.59
251 0.66
252 0.69
253 0.64
254 0.64
255 0.62
256 0.66
257 0.6
258 0.52
259 0.45
260 0.38
261 0.35
262 0.26
263 0.2
264 0.13
265 0.11
266 0.11
267 0.13
268 0.14
269 0.12
270 0.13
271 0.12
272 0.15
273 0.19
274 0.18
275 0.15
276 0.15
277 0.15
278 0.15
279 0.14
280 0.1
281 0.07
282 0.06
283 0.08
284 0.08
285 0.1
286 0.11
287 0.14
288 0.17
289 0.18
290 0.19
291 0.2
292 0.26
293 0.24
294 0.25
295 0.25
296 0.23
297 0.23
298 0.23
299 0.22
300 0.18
301 0.19
302 0.2
303 0.18
304 0.19
305 0.23
306 0.26
307 0.29
308 0.28
309 0.27
310 0.24
311 0.26
312 0.3
313 0.26
314 0.24
315 0.25
316 0.28
317 0.3
318 0.31
319 0.31
320 0.3
321 0.33
322 0.32