Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VPY5

Protein Details
Accession A0A0M9VPY5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-100DSCFRVRRAGQRRRKSVRGCHydrophilic
181-212QRLITPQRLQRKRDARRVKKERVVKQKAARAEHydrophilic
NLS Segment(s)
PositionSequence
166-210PKKEGAKPYTKAPKIQRLITPQRLQRKRDARRVKKERVVKQKAAR
Subcellular Location(s) cyto_nucl 13.333, cyto 13, nucl 11.5, mito_nucl 7.166, cyto_pero 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLNVANPATGAQKSFEFMDERLVRCFYDKRMSQDVEVDSLGDEWKGYVLRIGGGNDKQGFPMKQGVLLPSRVRLLLGEGDSCFRVRRAGQRRRKSVRGCIVGPDIQALHCIIVKQGEQEIPGLTDAESAVPKRLGPKRANHIRKFFNLSKEDDVRQYVIRREVQPKKEGAKPYTKAPKIQRLITPQRLQRKRDARRVKKERVVKQKAARAEYDALVAKRLGERKQRLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.17
5 0.17
6 0.26
7 0.29
8 0.3
9 0.31
10 0.31
11 0.29
12 0.3
13 0.33
14 0.29
15 0.34
16 0.36
17 0.4
18 0.48
19 0.49
20 0.46
21 0.49
22 0.45
23 0.38
24 0.33
25 0.26
26 0.18
27 0.17
28 0.15
29 0.09
30 0.08
31 0.05
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.11
39 0.13
40 0.17
41 0.17
42 0.22
43 0.22
44 0.22
45 0.22
46 0.24
47 0.23
48 0.2
49 0.26
50 0.21
51 0.22
52 0.23
53 0.25
54 0.23
55 0.26
56 0.24
57 0.2
58 0.21
59 0.18
60 0.17
61 0.14
62 0.14
63 0.13
64 0.13
65 0.12
66 0.12
67 0.13
68 0.13
69 0.14
70 0.12
71 0.09
72 0.11
73 0.12
74 0.22
75 0.32
76 0.42
77 0.52
78 0.61
79 0.71
80 0.76
81 0.82
82 0.77
83 0.76
84 0.74
85 0.69
86 0.6
87 0.53
88 0.49
89 0.41
90 0.36
91 0.27
92 0.18
93 0.13
94 0.12
95 0.09
96 0.06
97 0.06
98 0.06
99 0.05
100 0.06
101 0.07
102 0.07
103 0.08
104 0.08
105 0.08
106 0.09
107 0.09
108 0.08
109 0.08
110 0.07
111 0.06
112 0.06
113 0.05
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07
119 0.08
120 0.15
121 0.2
122 0.27
123 0.31
124 0.37
125 0.46
126 0.57
127 0.66
128 0.66
129 0.68
130 0.65
131 0.65
132 0.66
133 0.6
134 0.57
135 0.51
136 0.48
137 0.47
138 0.45
139 0.43
140 0.36
141 0.34
142 0.28
143 0.28
144 0.27
145 0.25
146 0.27
147 0.3
148 0.33
149 0.41
150 0.48
151 0.5
152 0.52
153 0.54
154 0.53
155 0.54
156 0.57
157 0.52
158 0.53
159 0.5
160 0.54
161 0.6
162 0.58
163 0.59
164 0.6
165 0.66
166 0.61
167 0.64
168 0.61
169 0.6
170 0.67
171 0.69
172 0.69
173 0.65
174 0.71
175 0.73
176 0.71
177 0.71
178 0.73
179 0.73
180 0.76
181 0.81
182 0.81
183 0.85
184 0.91
185 0.91
186 0.89
187 0.89
188 0.88
189 0.88
190 0.87
191 0.85
192 0.84
193 0.81
194 0.79
195 0.73
196 0.65
197 0.59
198 0.53
199 0.44
200 0.4
201 0.38
202 0.3
203 0.28
204 0.26
205 0.23
206 0.25
207 0.3
208 0.33
209 0.38
210 0.47