Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8MNY6

Protein Details
Accession A0A0M8MNY6   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
7-37SMGKRHTKTHTICRRCNRRAFHRQKKTCAACHydrophilic
NLS Segment(s)
PositionSequence
55-75RRKTTGSGRMRHLKSVPRRAK
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MTKGTTSMGKRHTKTHTICRRCNRRAFHRQKKTCAACGYPSAKTRNYQWGQKAIRRKTTGSGRMRHLKSVPRRAKNGFRTGTAVAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.68
4 0.68
5 0.75
6 0.79
7 0.82
8 0.81
9 0.83
10 0.81
11 0.8
12 0.83
13 0.85
14 0.85
15 0.86
16 0.85
17 0.84
18 0.86
19 0.79
20 0.74
21 0.66
22 0.57
23 0.48
24 0.47
25 0.43
26 0.36
27 0.36
28 0.33
29 0.31
30 0.3
31 0.31
32 0.35
33 0.34
34 0.36
35 0.36
36 0.41
37 0.44
38 0.48
39 0.55
40 0.5
41 0.56
42 0.53
43 0.52
44 0.5
45 0.55
46 0.59
47 0.58
48 0.57
49 0.57
50 0.63
51 0.63
52 0.6
53 0.55
54 0.55
55 0.58
56 0.63
57 0.66
58 0.64
59 0.69
60 0.72
61 0.77
62 0.77
63 0.77
64 0.69
65 0.62
66 0.59
67 0.54
68 0.49