Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VNN4

Protein Details
Accession A0A0M9VNN4   
Localization Confidence High
Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MALRNYVQRRNHKERSQPEHRKHLGLHydrophilic
34-61VERARAHHIKRDKLQRLRQKAADRNQDEHydrophilic
177-202EELKQVAKENRRKSKKKETLEEEQDEAcidic
NLS Segment(s)
PositionSequence
40-44HHIKR
186-193NRRKSKKK
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MALRNYVQRRNHKERSQPEHRKHLGLLEKHKDYVERARAHHIKRDKLQRLRQKAADRNQDEFYLGMIGKKTEKGVHIESRGNKALDNDVVSLLKTQDAGYLRKQLNSERKKYQALIEELAPRVPGMRLAYLEKKPDLVTALRKANLLGDVQTSSASAQQQGRVQGFGKKTKWVDDVEELKQVAKENRRKSKKKETLEEEQDERLVQAEKIGERQLSIKIRELATRQRRIDALTEASQKLDVVRSLMRTRGSHAVPKKQVQELKDAVGKRGAKVTSRGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.86
4 0.87
5 0.86
6 0.86
7 0.82
8 0.76
9 0.66
10 0.65
11 0.62
12 0.59
13 0.61
14 0.59
15 0.57
16 0.55
17 0.55
18 0.48
19 0.44
20 0.46
21 0.45
22 0.42
23 0.42
24 0.5
25 0.57
26 0.59
27 0.63
28 0.61
29 0.61
30 0.64
31 0.72
32 0.72
33 0.74
34 0.81
35 0.83
36 0.84
37 0.83
38 0.82
39 0.81
40 0.8
41 0.79
42 0.8
43 0.73
44 0.68
45 0.62
46 0.55
47 0.46
48 0.36
49 0.27
50 0.19
51 0.15
52 0.13
53 0.11
54 0.12
55 0.13
56 0.14
57 0.15
58 0.15
59 0.17
60 0.21
61 0.26
62 0.31
63 0.34
64 0.39
65 0.41
66 0.44
67 0.46
68 0.41
69 0.35
70 0.3
71 0.29
72 0.25
73 0.23
74 0.17
75 0.15
76 0.15
77 0.14
78 0.14
79 0.11
80 0.09
81 0.08
82 0.07
83 0.1
84 0.13
85 0.15
86 0.17
87 0.25
88 0.25
89 0.27
90 0.29
91 0.32
92 0.4
93 0.46
94 0.49
95 0.47
96 0.51
97 0.51
98 0.51
99 0.48
100 0.45
101 0.4
102 0.35
103 0.32
104 0.3
105 0.28
106 0.26
107 0.22
108 0.14
109 0.12
110 0.1
111 0.09
112 0.08
113 0.08
114 0.09
115 0.13
116 0.18
117 0.19
118 0.21
119 0.2
120 0.19
121 0.19
122 0.18
123 0.17
124 0.14
125 0.16
126 0.19
127 0.22
128 0.22
129 0.22
130 0.21
131 0.2
132 0.19
133 0.15
134 0.1
135 0.08
136 0.08
137 0.08
138 0.08
139 0.07
140 0.06
141 0.08
142 0.08
143 0.1
144 0.1
145 0.13
146 0.15
147 0.18
148 0.18
149 0.18
150 0.18
151 0.21
152 0.24
153 0.28
154 0.27
155 0.29
156 0.3
157 0.32
158 0.35
159 0.31
160 0.31
161 0.31
162 0.34
163 0.3
164 0.32
165 0.28
166 0.26
167 0.25
168 0.25
169 0.24
170 0.28
171 0.35
172 0.42
173 0.52
174 0.62
175 0.69
176 0.75
177 0.81
178 0.82
179 0.83
180 0.84
181 0.8
182 0.8
183 0.8
184 0.76
185 0.67
186 0.58
187 0.49
188 0.39
189 0.32
190 0.23
191 0.16
192 0.11
193 0.1
194 0.12
195 0.12
196 0.15
197 0.17
198 0.16
199 0.15
200 0.17
201 0.22
202 0.25
203 0.26
204 0.29
205 0.31
206 0.32
207 0.36
208 0.38
209 0.42
210 0.46
211 0.53
212 0.49
213 0.49
214 0.49
215 0.47
216 0.47
217 0.4
218 0.36
219 0.33
220 0.36
221 0.33
222 0.33
223 0.31
224 0.27
225 0.24
226 0.21
227 0.15
228 0.13
229 0.16
230 0.2
231 0.23
232 0.27
233 0.3
234 0.28
235 0.32
236 0.37
237 0.38
238 0.42
239 0.47
240 0.54
241 0.57
242 0.63
243 0.64
244 0.64
245 0.65
246 0.58
247 0.6
248 0.52
249 0.51
250 0.5
251 0.45
252 0.4
253 0.43
254 0.42
255 0.35
256 0.39
257 0.36
258 0.34