Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8PGC0

Protein Details
Accession A0A0M8PGC0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
5-39LSFISIKKKERQMEREKKKKKKKKKQTAPLAPILAHydrophilic
NLS Segment(s)
PositionSequence
11-29KKKERQMEREKKKKKKKKK
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MIDFLSFISIKKKERQMEREKKKKKKKKKQTAPLAPILALYKLTYKLRCSYQNIILEVQRFECFLLEQSIKCRGIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.65
3 0.69
4 0.76
5 0.83
6 0.86
7 0.88
8 0.91
9 0.93
10 0.94
11 0.94
12 0.94
13 0.94
14 0.95
15 0.96
16 0.95
17 0.96
18 0.95
19 0.9
20 0.84
21 0.73
22 0.62
23 0.51
24 0.41
25 0.29
26 0.18
27 0.12
28 0.08
29 0.1
30 0.13
31 0.14
32 0.16
33 0.19
34 0.24
35 0.29
36 0.34
37 0.36
38 0.41
39 0.44
40 0.44
41 0.42
42 0.4
43 0.36
44 0.31
45 0.28
46 0.21
47 0.16
48 0.14
49 0.13
50 0.12
51 0.12
52 0.17
53 0.17
54 0.18
55 0.22
56 0.29