Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9W9F2

Protein Details
Accession A0A0M9W9F2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
271-304VLPQWQQRYRRCDPCRTEKRRRKRSSLALSYREVHydrophilic
NLS Segment(s)
PositionSequence
290-293RRRK
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MWGWRCKNLCPVTISSKVRSIQFLLPLNPYATSMPPSPPPSQFCIRCAAPVPSLGLPNRSQSVRCKTCIRSIRDGGPKWLCESRYCTICGTTLSASTKYARCAPCRANESVAVPSPVETIQRSCDSCSRVLPPYEQTRRVCSRCRRVRTIKMQTQSPPQLSSVPTTSSNHSPSVTATLPTLAPAPARSSLPTLAPSSAQRSPPMLDPSSAQRYLPILAPTPPRNSLPMLAPSSVRSPSSTHRPLLMRTPGTPSPFTPTTVTPRKCDGCDIVLPQWQQRYRRCDPCRTEKRRRKRSSLALSYREVLAEMSPSMQQNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.5
3 0.52
4 0.5
5 0.48
6 0.45
7 0.42
8 0.38
9 0.41
10 0.42
11 0.38
12 0.38
13 0.37
14 0.35
15 0.31
16 0.28
17 0.22
18 0.19
19 0.2
20 0.19
21 0.2
22 0.25
23 0.3
24 0.32
25 0.36
26 0.39
27 0.41
28 0.48
29 0.48
30 0.44
31 0.45
32 0.42
33 0.39
34 0.39
35 0.36
36 0.29
37 0.27
38 0.29
39 0.24
40 0.28
41 0.26
42 0.26
43 0.24
44 0.26
45 0.28
46 0.26
47 0.27
48 0.31
49 0.41
50 0.42
51 0.44
52 0.48
53 0.48
54 0.56
55 0.62
56 0.6
57 0.59
58 0.58
59 0.63
60 0.65
61 0.63
62 0.61
63 0.57
64 0.51
65 0.46
66 0.46
67 0.39
68 0.33
69 0.37
70 0.34
71 0.32
72 0.33
73 0.3
74 0.26
75 0.26
76 0.24
77 0.2
78 0.16
79 0.17
80 0.18
81 0.17
82 0.18
83 0.2
84 0.21
85 0.21
86 0.27
87 0.28
88 0.29
89 0.35
90 0.37
91 0.41
92 0.44
93 0.44
94 0.39
95 0.37
96 0.36
97 0.32
98 0.29
99 0.23
100 0.18
101 0.16
102 0.15
103 0.13
104 0.12
105 0.1
106 0.1
107 0.12
108 0.16
109 0.16
110 0.17
111 0.2
112 0.22
113 0.22
114 0.23
115 0.24
116 0.24
117 0.25
118 0.25
119 0.26
120 0.33
121 0.37
122 0.41
123 0.39
124 0.43
125 0.49
126 0.5
127 0.54
128 0.53
129 0.59
130 0.62
131 0.67
132 0.69
133 0.71
134 0.77
135 0.79
136 0.8
137 0.75
138 0.69
139 0.66
140 0.6
141 0.58
142 0.53
143 0.44
144 0.34
145 0.29
146 0.27
147 0.24
148 0.23
149 0.17
150 0.15
151 0.16
152 0.16
153 0.18
154 0.19
155 0.21
156 0.2
157 0.19
158 0.17
159 0.16
160 0.18
161 0.16
162 0.13
163 0.11
164 0.11
165 0.1
166 0.1
167 0.11
168 0.07
169 0.07
170 0.07
171 0.09
172 0.09
173 0.1
174 0.11
175 0.12
176 0.13
177 0.14
178 0.15
179 0.14
180 0.13
181 0.14
182 0.15
183 0.18
184 0.21
185 0.21
186 0.2
187 0.2
188 0.21
189 0.25
190 0.28
191 0.24
192 0.21
193 0.21
194 0.26
195 0.3
196 0.29
197 0.24
198 0.21
199 0.21
200 0.22
201 0.23
202 0.18
203 0.14
204 0.17
205 0.24
206 0.26
207 0.28
208 0.3
209 0.28
210 0.28
211 0.29
212 0.27
213 0.24
214 0.27
215 0.26
216 0.24
217 0.24
218 0.24
219 0.25
220 0.24
221 0.21
222 0.17
223 0.17
224 0.22
225 0.31
226 0.34
227 0.33
228 0.37
229 0.38
230 0.39
231 0.44
232 0.47
233 0.39
234 0.36
235 0.42
236 0.4
237 0.42
238 0.41
239 0.34
240 0.33
241 0.32
242 0.33
243 0.29
244 0.29
245 0.34
246 0.43
247 0.45
248 0.4
249 0.47
250 0.48
251 0.47
252 0.48
253 0.42
254 0.37
255 0.38
256 0.39
257 0.36
258 0.37
259 0.37
260 0.36
261 0.41
262 0.41
263 0.45
264 0.48
265 0.53
266 0.57
267 0.67
268 0.7
269 0.73
270 0.76
271 0.8
272 0.83
273 0.85
274 0.87
275 0.87
276 0.91
277 0.92
278 0.93
279 0.91
280 0.9
281 0.91
282 0.91
283 0.91
284 0.9
285 0.84
286 0.78
287 0.7
288 0.6
289 0.49
290 0.39
291 0.28
292 0.19
293 0.15
294 0.12
295 0.11
296 0.13