FuNGI

A0A2A9PP84

Protein Details

Accession

A0A2A9PP84

Localization Confidence

Low

Confidence Score

6.3

NoLS Segment(s)

Position	Sequence	Protein Nature
76-97	RIQSCIQRFRARRRLQTDRSLY	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 13.5, cyto_nucl 10.5, pero 6, nucl 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR018606 Arb1
Gene Ontology	GO:0033167 C:ARC complex GO:0031047 P:RNA-mediated gene silencing
Pfam	View protein in Pfam PF09692 Arb1

Amino Acid Sequences

MPSKLPAQDDQGGEVQLENGAAAKKASEGKSSKPLRLPKSRGTGFEEYFADPPMTPDEAAEEKNEIYASDIPFETRIQSCIQRFRARRRLQTDRSLYFNEYLFLGGIDTNPNVFGGQHHSDLRHLTPAERRDITATDTVHSESTTSERFYRAGDDNWSVDFTGVLAGFFSTSLISLTGGIRKDMETAANVIDNFLRYVRQHDVCPEYEKDVNRALDLCADARREWVLLEKLRTSFPGRFHQAATQLFSPSSSQDWDSPSIAQPTQLDNEAVFYSACALLGETEALTAAKRGNTAVVREYDCTLEVVSVQLPSTKLAERFRSLVIGQVQHHPNPIGKAFFKTAAIEEGWLDPTMESPHAAAIAWLYFEQSILDNLKPGMKLAMTISELSVGVRFVKAWKNLVPSYYTFLPQVLMKHYKVPKPNERPAASVHDPDAEEKQHANEAEA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.19
3	0.13
4	0.12
5	0.09
6	0.08
7	0.09
8	0.09
9	0.09
10	0.09
11	0.12
12	0.19
13	0.21
14	0.28
15	0.3
16	0.36
17	0.46
18	0.51
19	0.54
20	0.55
21	0.62
22	0.63
23	0.71
24	0.72
25	0.71
26	0.76
27	0.73
28	0.7
29	0.69
30	0.67
31	0.57
32	0.55
33	0.48
34	0.4
35	0.37
36	0.34
37	0.27
38	0.19
39	0.19
40	0.18
41	0.18
42	0.15
43	0.14
44	0.17
45	0.19
46	0.2
47	0.2
48	0.18
49	0.16
50	0.17
51	0.17
52	0.12
53	0.13
54	0.17
55	0.16
56	0.17
57	0.17
58	0.17
59	0.18
60	0.19
61	0.19
62	0.16
63	0.17
64	0.17
65	0.24
66	0.29
67	0.36
68	0.43
69	0.49
70	0.55
71	0.64
72	0.71
73	0.73
74	0.77
75	0.77
76	0.8
77	0.78
78	0.82
79	0.8
80	0.72
81	0.69
82	0.62
83	0.56
84	0.47
85	0.4
86	0.31
87	0.22
88	0.19
89	0.14
90	0.11
91	0.09
92	0.07
93	0.07
94	0.08
95	0.08
96	0.07
97	0.08
98	0.08
99	0.07
100	0.07
101	0.08
102	0.13
103	0.16
104	0.19
105	0.2
106	0.21
107	0.22
108	0.25
109	0.24
110	0.23
111	0.21
112	0.21
113	0.26
114	0.29
115	0.34
116	0.32
117	0.31
118	0.28
119	0.29
120	0.29
121	0.27
122	0.24
123	0.19
124	0.19
125	0.19
126	0.17
127	0.16
128	0.13
129	0.09
130	0.11
131	0.12
132	0.13
133	0.13
134	0.14
135	0.15
136	0.15
137	0.19
138	0.19
139	0.19
140	0.21
141	0.22
142	0.22
143	0.22
144	0.21
145	0.17
146	0.14
147	0.12
148	0.08
149	0.07
150	0.06
151	0.05
152	0.05
153	0.05
154	0.05
155	0.05
156	0.05
157	0.03
158	0.03
159	0.04
160	0.04
161	0.04
162	0.05
163	0.06
164	0.09
165	0.1
166	0.1
167	0.1
168	0.1
169	0.11
170	0.11
171	0.11
172	0.08
173	0.09
174	0.09
175	0.1
176	0.09
177	0.09
178	0.08
179	0.08
180	0.08
181	0.07
182	0.08
183	0.07
184	0.11
185	0.16
186	0.17
187	0.18
188	0.21
189	0.24
190	0.25
191	0.28
192	0.25
193	0.23
194	0.25
195	0.25
196	0.24
197	0.25
198	0.23
199	0.2
200	0.2
201	0.17
202	0.14
203	0.14
204	0.12
205	0.1
206	0.11
207	0.1
208	0.1
209	0.11
210	0.09
211	0.09
212	0.11
213	0.14
214	0.15
215	0.16
216	0.17
217	0.18
218	0.18
219	0.2
220	0.2
221	0.2
222	0.22
223	0.28
224	0.3
225	0.3
226	0.31
227	0.32
228	0.34
229	0.31
230	0.3
231	0.23
232	0.2
233	0.18
234	0.18
235	0.16
236	0.11
237	0.11
238	0.1
239	0.1
240	0.11
241	0.14
242	0.15
243	0.16
244	0.16
245	0.16
246	0.18
247	0.17
248	0.16
249	0.15
250	0.15
251	0.15
252	0.15
253	0.14
254	0.11
255	0.12
256	0.11
257	0.1
258	0.08
259	0.06
260	0.07
261	0.07
262	0.07
263	0.05
264	0.05
265	0.05
266	0.05
267	0.05
268	0.04
269	0.04
270	0.04
271	0.04
272	0.04
273	0.05
274	0.06
275	0.06
276	0.07
277	0.07
278	0.11
279	0.13
280	0.15
281	0.17
282	0.19
283	0.2
284	0.21
285	0.22
286	0.19
287	0.18
288	0.16
289	0.13
290	0.1
291	0.08
292	0.07
293	0.07
294	0.07
295	0.06
296	0.08
297	0.08
298	0.09
299	0.11
300	0.13
301	0.17
302	0.22
303	0.27
304	0.27
305	0.29
306	0.29
307	0.29
308	0.26
309	0.27
310	0.26
311	0.26
312	0.25
313	0.3
314	0.33
315	0.31
316	0.33
317	0.29
318	0.27
319	0.26
320	0.27
321	0.24
322	0.22
323	0.25
324	0.25
325	0.25
326	0.24
327	0.22
328	0.21
329	0.19
330	0.18
331	0.15
332	0.14
333	0.14
334	0.14
335	0.13
336	0.12
337	0.09
338	0.1
339	0.12
340	0.11
341	0.1
342	0.09
343	0.09
344	0.09
345	0.09
346	0.08
347	0.07
348	0.07
349	0.07
350	0.07
351	0.07
352	0.07
353	0.07
354	0.08
355	0.07
356	0.1
357	0.12
358	0.12
359	0.13
360	0.14
361	0.17
362	0.16
363	0.16
364	0.15
365	0.12
366	0.14
367	0.14
368	0.17
369	0.16
370	0.16
371	0.16
372	0.15
373	0.15
374	0.14
375	0.13
376	0.1
377	0.09
378	0.09
379	0.09
380	0.13
381	0.2
382	0.23
383	0.27
384	0.31
385	0.37
386	0.39
387	0.4
388	0.4
389	0.35
390	0.38
391	0.36
392	0.33
393	0.26
394	0.25
395	0.24
396	0.22
397	0.23
398	0.25
399	0.28
400	0.28
401	0.36
402	0.43
403	0.49
404	0.55
405	0.62
406	0.66
407	0.7
408	0.78
409	0.79
410	0.75
411	0.71
412	0.67
413	0.66
414	0.6
415	0.53
416	0.45
417	0.4
418	0.38
419	0.38
420	0.38
421	0.31
422	0.29
423	0.27
424	0.28
425	0.28

A0A2A9PP84

3D AlphaFold-predicted Structure Viewer