Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PP84

Protein Details
Accession A0A2A9PP84   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-97RIQSCIQRFRARRRLQTDRSLYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 10.5, pero 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018606  Arb1  
Gene Ontology GO:0033167  C:ARC complex  
GO:0031047  P:RNA-mediated gene silencing  
Pfam View protein in Pfam  
PF09692  Arb1  
Amino Acid Sequences MPSKLPAQDDQGGEVQLENGAAAKKASEGKSSKPLRLPKSRGTGFEEYFADPPMTPDEAAEEKNEIYASDIPFETRIQSCIQRFRARRRLQTDRSLYFNEYLFLGGIDTNPNVFGGQHHSDLRHLTPAERRDITATDTVHSESTTSERFYRAGDDNWSVDFTGVLAGFFSTSLISLTGGIRKDMETAANVIDNFLRYVRQHDVCPEYEKDVNRALDLCADARREWVLLEKLRTSFPGRFHQAATQLFSPSSSQDWDSPSIAQPTQLDNEAVFYSACALLGETEALTAAKRGNTAVVREYDCTLEVVSVQLPSTKLAERFRSLVIGQVQHHPNPIGKAFFKTAAIEEGWLDPTMESPHAAAIAWLYFEQSILDNLKPGMKLAMTISELSVGVRFVKAWKNLVPSYYTFLPQVLMKHYKVPKPNERPAASVHDPDAEEKQHANEAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.13
4 0.12
5 0.09
6 0.08
7 0.09
8 0.09
9 0.09
10 0.09
11 0.12
12 0.19
13 0.21
14 0.28
15 0.3
16 0.36
17 0.46
18 0.51
19 0.54
20 0.55
21 0.62
22 0.63
23 0.71
24 0.72
25 0.71
26 0.76
27 0.73
28 0.7
29 0.69
30 0.67
31 0.57
32 0.55
33 0.48
34 0.4
35 0.37
36 0.34
37 0.27
38 0.19
39 0.19
40 0.18
41 0.18
42 0.15
43 0.14
44 0.17
45 0.19
46 0.2
47 0.2
48 0.18
49 0.16
50 0.17
51 0.17
52 0.12
53 0.13
54 0.17
55 0.16
56 0.17
57 0.17
58 0.17
59 0.18
60 0.19
61 0.19
62 0.16
63 0.17
64 0.17
65 0.24
66 0.29
67 0.36
68 0.43
69 0.49
70 0.55
71 0.64
72 0.71
73 0.73
74 0.77
75 0.77
76 0.8
77 0.78
78 0.82
79 0.8
80 0.72
81 0.69
82 0.62
83 0.56
84 0.47
85 0.4
86 0.31
87 0.22
88 0.19
89 0.14
90 0.11
91 0.09
92 0.07
93 0.07
94 0.08
95 0.08
96 0.07
97 0.08
98 0.08
99 0.07
100 0.07
101 0.08
102 0.13
103 0.16
104 0.19
105 0.2
106 0.21
107 0.22
108 0.25
109 0.24
110 0.23
111 0.21
112 0.21
113 0.26
114 0.29
115 0.34
116 0.32
117 0.31
118 0.28
119 0.29
120 0.29
121 0.27
122 0.24
123 0.19
124 0.19
125 0.19
126 0.17
127 0.16
128 0.13
129 0.09
130 0.11
131 0.12
132 0.13
133 0.13
134 0.14
135 0.15
136 0.15
137 0.19
138 0.19
139 0.19
140 0.21
141 0.22
142 0.22
143 0.22
144 0.21
145 0.17
146 0.14
147 0.12
148 0.08
149 0.07
150 0.06
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.03
158 0.03
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.09
165 0.1
166 0.1
167 0.1
168 0.1
169 0.11
170 0.11
171 0.11
172 0.08
173 0.09
174 0.09
175 0.1
176 0.09
177 0.09
178 0.08
179 0.08
180 0.08
181 0.07
182 0.08
183 0.07
184 0.11
185 0.16
186 0.17
187 0.18
188 0.21
189 0.24
190 0.25
191 0.28
192 0.25
193 0.23
194 0.25
195 0.25
196 0.24
197 0.25
198 0.23
199 0.2
200 0.2
201 0.17
202 0.14
203 0.14
204 0.12
205 0.1
206 0.11
207 0.1
208 0.1
209 0.11
210 0.09
211 0.09
212 0.11
213 0.14
214 0.15
215 0.16
216 0.17
217 0.18
218 0.18
219 0.2
220 0.2
221 0.2
222 0.22
223 0.28
224 0.3
225 0.3
226 0.31
227 0.32
228 0.34
229 0.31
230 0.3
231 0.23
232 0.2
233 0.18
234 0.18
235 0.16
236 0.11
237 0.11
238 0.1
239 0.1
240 0.11
241 0.14
242 0.15
243 0.16
244 0.16
245 0.16
246 0.18
247 0.17
248 0.16
249 0.15
250 0.15
251 0.15
252 0.15
253 0.14
254 0.11
255 0.12
256 0.11
257 0.1
258 0.08
259 0.06
260 0.07
261 0.07
262 0.07
263 0.05
264 0.05
265 0.05
266 0.05
267 0.05
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04
273 0.05
274 0.06
275 0.06
276 0.07
277 0.07
278 0.11
279 0.13
280 0.15
281 0.17
282 0.19
283 0.2
284 0.21
285 0.22
286 0.19
287 0.18
288 0.16
289 0.13
290 0.1
291 0.08
292 0.07
293 0.07
294 0.07
295 0.06
296 0.08
297 0.08
298 0.09
299 0.11
300 0.13
301 0.17
302 0.22
303 0.27
304 0.27
305 0.29
306 0.29
307 0.29
308 0.26
309 0.27
310 0.26
311 0.26
312 0.25
313 0.3
314 0.33
315 0.31
316 0.33
317 0.29
318 0.27
319 0.26
320 0.27
321 0.24
322 0.22
323 0.25
324 0.25
325 0.25
326 0.24
327 0.22
328 0.21
329 0.19
330 0.18
331 0.15
332 0.14
333 0.14
334 0.14
335 0.13
336 0.12
337 0.09
338 0.1
339 0.12
340 0.11
341 0.1
342 0.09
343 0.09
344 0.09
345 0.09
346 0.08
347 0.07
348 0.07
349 0.07
350 0.07
351 0.07
352 0.07
353 0.07
354 0.08
355 0.07
356 0.1
357 0.12
358 0.12
359 0.13
360 0.14
361 0.17
362 0.16
363 0.16
364 0.15
365 0.12
366 0.14
367 0.14
368 0.17
369 0.16
370 0.16
371 0.16
372 0.15
373 0.15
374 0.14
375 0.13
376 0.1
377 0.09
378 0.09
379 0.09
380 0.13
381 0.2
382 0.23
383 0.27
384 0.31
385 0.37
386 0.39
387 0.4
388 0.4
389 0.35
390 0.38
391 0.36
392 0.33
393 0.26
394 0.25
395 0.24
396 0.22
397 0.23
398 0.25
399 0.28
400 0.28
401 0.36
402 0.43
403 0.49
404 0.55
405 0.62
406 0.66
407 0.7
408 0.78
409 0.79
410 0.75
411 0.71
412 0.67
413 0.66
414 0.6
415 0.53
416 0.45
417 0.4
418 0.38
419 0.38
420 0.38
421 0.31
422 0.29
423 0.27
424 0.28
425 0.28