Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9PEU4

Protein Details
Accession A0A2A9PEU4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-100PPHGQDKTRKTNKSKPKNRNEGPDIBasic
163-187DSITADPKLKRQKKKFDDLVNSDSLHydrophilic
NLS Segment(s)
PositionSequence
82-92KTRKTNKSKPK
Subcellular Location(s) extr 9, nucl 8, mito 7, E.R. 2
Family & Domain DBs
Amino Acid Sequences MIAQGLSCLLLSAALSLMLFIGHGDATPVPTWGHPYHIWSPWLSRQTPGWWPPPGPRWPPRMGLPNNFSPPDGKSPPHGQDKTRKTNKSKPKNRNEGPDISDETPDTGQDGPGVTGKAPETRTDPPQTEEDPSDTGKDSQEPKDNEIESEGATENSKEAPDPDSITADPKLKRQKKKFDDLVNSDSLES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.06
13 0.08
14 0.09
15 0.1
16 0.1
17 0.1
18 0.16
19 0.15
20 0.2
21 0.19
22 0.25
23 0.29
24 0.32
25 0.33
26 0.29
27 0.33
28 0.35
29 0.39
30 0.34
31 0.31
32 0.3
33 0.32
34 0.39
35 0.39
36 0.38
37 0.35
38 0.36
39 0.39
40 0.44
41 0.47
42 0.47
43 0.49
44 0.49
45 0.5
46 0.52
47 0.52
48 0.54
49 0.51
50 0.51
51 0.49
52 0.49
53 0.49
54 0.46
55 0.41
56 0.33
57 0.31
58 0.3
59 0.28
60 0.23
61 0.23
62 0.29
63 0.34
64 0.42
65 0.42
66 0.39
67 0.46
68 0.54
69 0.6
70 0.63
71 0.65
72 0.63
73 0.7
74 0.77
75 0.78
76 0.8
77 0.8
78 0.82
79 0.86
80 0.83
81 0.82
82 0.76
83 0.69
84 0.61
85 0.54
86 0.47
87 0.37
88 0.33
89 0.24
90 0.21
91 0.16
92 0.13
93 0.11
94 0.08
95 0.07
96 0.07
97 0.07
98 0.06
99 0.07
100 0.08
101 0.07
102 0.08
103 0.08
104 0.12
105 0.12
106 0.13
107 0.17
108 0.2
109 0.25
110 0.29
111 0.3
112 0.28
113 0.31
114 0.32
115 0.3
116 0.28
117 0.25
118 0.23
119 0.22
120 0.2
121 0.18
122 0.18
123 0.16
124 0.19
125 0.21
126 0.24
127 0.31
128 0.32
129 0.34
130 0.39
131 0.38
132 0.34
133 0.32
134 0.28
135 0.2
136 0.2
137 0.17
138 0.12
139 0.12
140 0.12
141 0.1
142 0.1
143 0.1
144 0.09
145 0.09
146 0.11
147 0.13
148 0.16
149 0.17
150 0.19
151 0.19
152 0.22
153 0.24
154 0.28
155 0.28
156 0.33
157 0.43
158 0.49
159 0.59
160 0.66
161 0.74
162 0.78
163 0.87
164 0.88
165 0.87
166 0.88
167 0.85
168 0.8
169 0.72