Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PA93

Protein Details
Accession A0A2A9PA93   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-43TSAGPEPRTGRRRRRRRSASPASQLIHydrophilic
NLS Segment(s)
PositionSequence
24-35PRTGRRRRRRRS
Subcellular Location(s) plas 17, mito 4, E.R. 3, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MAGFGGREIFRWQDRPLTSAGPEPRTGRRRRRRRSASPASQLIESFKSALGFTVVWSLPLVLAMAHGSARGPVRVLSDKEECQLSLRLVFVRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.32
4 0.3
5 0.27
6 0.31
7 0.34
8 0.29
9 0.31
10 0.33
11 0.39
12 0.45
13 0.53
14 0.57
15 0.63
16 0.71
17 0.78
18 0.86
19 0.87
20 0.89
21 0.91
22 0.9
23 0.89
24 0.85
25 0.8
26 0.7
27 0.6
28 0.5
29 0.41
30 0.31
31 0.21
32 0.14
33 0.1
34 0.09
35 0.08
36 0.08
37 0.07
38 0.06
39 0.06
40 0.09
41 0.09
42 0.08
43 0.09
44 0.08
45 0.07
46 0.07
47 0.07
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.06
56 0.08
57 0.08
58 0.08
59 0.09
60 0.14
61 0.2
62 0.22
63 0.25
64 0.3
65 0.31
66 0.32
67 0.33
68 0.28
69 0.26
70 0.27
71 0.23
72 0.2
73 0.2