Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P4A3

Protein Details
Accession A0A2A9P4A3   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
396-419HSDGAEQRRRKNRGPPRKGRQVVABasic
NLS Segment(s)
PositionSequence
403-424RRRKNRGPPRKGRQVVALRARK
Subcellular Location(s) cyto 13.5, cyto_nucl 9.5, nucl 4.5, mito 4, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045260  Sec12-like  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0000139  C:Golgi membrane  
GO:0005096  F:GTPase activator activity  
GO:0005085  F:guanyl-nucleotide exchange factor activity  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0009306  P:protein secretion  
GO:0003400  P:regulation of COPII vesicle coating  
Amino Acid Sequences MAPSLPCASLELDYPLYALDFDPEDAARLVVGGGGGAGRSGVGNKITVLEVRQDELRVTTEAELSRDEDSVMSLAVGPSQGQGKPTRLFAGINSDMASGVNLHLRALALHHRSGARLAELTRTALFANTDADSYQRLLRLAGPVGAAASAMGKESQIAVFDSTGSQPKPRGLLQLPVDAEDLDLVQTAEGEFQLAFCYKHELHVVALTAEQNSEPRLIYTVPVADDDDGGPRPAFRAIRFLTPTFLLAVSNLPQRRGVLIQGFRMPSSATDMAAVAVAARISRNLSATALAVANPSPVTPSWAALGDAQFVIAVAGSDSSIRLYTLEHRAASTLNLLSGLDPVCTVAECHGRGSITGLAFSKPTSTGRGAKTVKLNLGSISLQKSVAVHAVPLKEHSDGAEQRRRKNRGPPRKGRQVVALRARKPSSTWLVVVLSLTVLLMAMVGQAVMELYGKSEPLLLGRRFSPEWHAALASSPPPPPPLDARMVQVTAPPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.12
5 0.11
6 0.09
7 0.09
8 0.1
9 0.11
10 0.11
11 0.13
12 0.13
13 0.13
14 0.1
15 0.09
16 0.08
17 0.07
18 0.07
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.03
26 0.04
27 0.05
28 0.08
29 0.09
30 0.09
31 0.1
32 0.12
33 0.13
34 0.14
35 0.14
36 0.18
37 0.18
38 0.2
39 0.21
40 0.2
41 0.2
42 0.21
43 0.22
44 0.17
45 0.17
46 0.16
47 0.19
48 0.19
49 0.2
50 0.19
51 0.19
52 0.19
53 0.17
54 0.16
55 0.12
56 0.12
57 0.11
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.07
66 0.1
67 0.11
68 0.14
69 0.18
70 0.23
71 0.25
72 0.27
73 0.28
74 0.26
75 0.26
76 0.24
77 0.29
78 0.25
79 0.24
80 0.22
81 0.2
82 0.19
83 0.18
84 0.17
85 0.08
86 0.08
87 0.1
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.11
94 0.18
95 0.19
96 0.19
97 0.22
98 0.22
99 0.23
100 0.25
101 0.24
102 0.18
103 0.17
104 0.17
105 0.18
106 0.18
107 0.19
108 0.17
109 0.17
110 0.15
111 0.14
112 0.13
113 0.1
114 0.11
115 0.1
116 0.1
117 0.09
118 0.1
119 0.1
120 0.11
121 0.12
122 0.12
123 0.12
124 0.12
125 0.14
126 0.16
127 0.16
128 0.15
129 0.13
130 0.12
131 0.11
132 0.1
133 0.08
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.08
148 0.08
149 0.09
150 0.13
151 0.13
152 0.14
153 0.15
154 0.16
155 0.19
156 0.19
157 0.24
158 0.22
159 0.29
160 0.29
161 0.33
162 0.32
163 0.3
164 0.29
165 0.23
166 0.21
167 0.14
168 0.11
169 0.05
170 0.05
171 0.04
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.06
182 0.06
183 0.06
184 0.12
185 0.12
186 0.14
187 0.15
188 0.14
189 0.14
190 0.15
191 0.15
192 0.1
193 0.11
194 0.09
195 0.08
196 0.08
197 0.07
198 0.06
199 0.07
200 0.07
201 0.06
202 0.06
203 0.07
204 0.08
205 0.08
206 0.08
207 0.09
208 0.08
209 0.09
210 0.09
211 0.08
212 0.08
213 0.08
214 0.09
215 0.08
216 0.08
217 0.07
218 0.07
219 0.07
220 0.1
221 0.11
222 0.1
223 0.17
224 0.18
225 0.23
226 0.25
227 0.25
228 0.23
229 0.22
230 0.22
231 0.16
232 0.14
233 0.09
234 0.07
235 0.08
236 0.08
237 0.12
238 0.13
239 0.13
240 0.13
241 0.13
242 0.14
243 0.14
244 0.14
245 0.16
246 0.17
247 0.18
248 0.21
249 0.21
250 0.2
251 0.19
252 0.17
253 0.12
254 0.16
255 0.14
256 0.11
257 0.11
258 0.11
259 0.1
260 0.1
261 0.1
262 0.04
263 0.04
264 0.04
265 0.03
266 0.03
267 0.04
268 0.05
269 0.05
270 0.06
271 0.07
272 0.07
273 0.08
274 0.08
275 0.09
276 0.08
277 0.08
278 0.07
279 0.06
280 0.07
281 0.06
282 0.06
283 0.06
284 0.06
285 0.09
286 0.09
287 0.1
288 0.1
289 0.11
290 0.12
291 0.12
292 0.12
293 0.09
294 0.09
295 0.08
296 0.07
297 0.06
298 0.05
299 0.04
300 0.03
301 0.02
302 0.03
303 0.03
304 0.03
305 0.03
306 0.04
307 0.04
308 0.04
309 0.05
310 0.06
311 0.11
312 0.17
313 0.19
314 0.19
315 0.19
316 0.2
317 0.2
318 0.2
319 0.17
320 0.11
321 0.09
322 0.09
323 0.08
324 0.08
325 0.09
326 0.09
327 0.07
328 0.06
329 0.07
330 0.06
331 0.06
332 0.07
333 0.08
334 0.12
335 0.13
336 0.14
337 0.15
338 0.15
339 0.15
340 0.17
341 0.18
342 0.13
343 0.15
344 0.15
345 0.14
346 0.14
347 0.14
348 0.13
349 0.11
350 0.12
351 0.15
352 0.18
353 0.24
354 0.26
355 0.36
356 0.36
357 0.39
358 0.44
359 0.44
360 0.43
361 0.39
362 0.37
363 0.28
364 0.29
365 0.26
366 0.22
367 0.21
368 0.19
369 0.17
370 0.17
371 0.16
372 0.15
373 0.16
374 0.13
375 0.11
376 0.14
377 0.16
378 0.16
379 0.18
380 0.18
381 0.17
382 0.17
383 0.17
384 0.21
385 0.25
386 0.33
387 0.4
388 0.43
389 0.51
390 0.61
391 0.66
392 0.65
393 0.7
394 0.73
395 0.76
396 0.82
397 0.84
398 0.84
399 0.89
400 0.87
401 0.79
402 0.78
403 0.76
404 0.74
405 0.74
406 0.72
407 0.64
408 0.67
409 0.66
410 0.57
411 0.5
412 0.48
413 0.45
414 0.4
415 0.38
416 0.33
417 0.32
418 0.32
419 0.3
420 0.22
421 0.14
422 0.1
423 0.09
424 0.05
425 0.04
426 0.03
427 0.03
428 0.03
429 0.03
430 0.03
431 0.03
432 0.02
433 0.03
434 0.03
435 0.03
436 0.04
437 0.04
438 0.05
439 0.06
440 0.07
441 0.07
442 0.09
443 0.09
444 0.13
445 0.22
446 0.22
447 0.25
448 0.26
449 0.32
450 0.31
451 0.33
452 0.36
453 0.33
454 0.33
455 0.32
456 0.31
457 0.26
458 0.27
459 0.29
460 0.24
461 0.22
462 0.21
463 0.2
464 0.22
465 0.23
466 0.25
467 0.28
468 0.3
469 0.34
470 0.34
471 0.38
472 0.4
473 0.39
474 0.36