Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PB14

Protein Details
Accession A0A2A9PB14    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MRRRETNKAKSPPLKTKNSRQPCKKTRQLNKQATPKAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MRRRETNKAKSPPLKTKNSRQPCKKTRQLNKQATPKAVCFLLHKTPPPSEAKQRRSSRGTEHPLHRRCGLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.81
4 0.82
5 0.84
6 0.85
7 0.85
8 0.87
9 0.86
10 0.88
11 0.86
12 0.86
13 0.85
14 0.86
15 0.87
16 0.87
17 0.86
18 0.85
19 0.81
20 0.75
21 0.66
22 0.56
23 0.46
24 0.36
25 0.28
26 0.21
27 0.21
28 0.23
29 0.23
30 0.26
31 0.28
32 0.28
33 0.31
34 0.35
35 0.35
36 0.4
37 0.47
38 0.52
39 0.59
40 0.65
41 0.69
42 0.68
43 0.67
44 0.65
45 0.65
46 0.66
47 0.64
48 0.67
49 0.7
50 0.71
51 0.72