Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9PQV6

Protein Details
Accession A0A2A9PQV6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
55-75MAPLAPQQKKQRDLRHREAVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto_nucl 8, nucl 6.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MRKPNFDKLNSIRPVEVFCQVSALSHPRDRCNGVPQIYRGKVFLAGYDIRVSVGMAPLAPQQKKQRDLRHREAVTGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.36
3 0.35
4 0.26
5 0.21
6 0.21
7 0.19
8 0.19
9 0.18
10 0.19
11 0.18
12 0.2
13 0.23
14 0.24
15 0.27
16 0.3
17 0.3
18 0.32
19 0.34
20 0.34
21 0.35
22 0.35
23 0.39
24 0.37
25 0.35
26 0.29
27 0.24
28 0.22
29 0.19
30 0.16
31 0.13
32 0.12
33 0.12
34 0.13
35 0.12
36 0.1
37 0.1
38 0.1
39 0.07
40 0.07
41 0.06
42 0.05
43 0.06
44 0.11
45 0.17
46 0.18
47 0.24
48 0.33
49 0.41
50 0.49
51 0.58
52 0.64
53 0.69
54 0.78
55 0.81
56 0.83
57 0.76