Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PG61

Protein Details
Accession A0A2A9PG61    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
409-449LRHVHIPSRKTPRKARGWEAKRQGPKYRHLWKYTRRIRGLSBasic
NLS Segment(s)
PositionSequence
416-458SRKTPRKARGWEAKRQGPKYRHLWKYTRRIRGLSTGRGWIKRR
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008914  PEBP  
IPR036610  PEBP-like_sf  
IPR035810  PEBP_euk  
Pfam View protein in Pfam  
PF01161  PBP  
CDD cd00866  PEBP_euk  
Amino Acid Sequences MASFRHVARPLAGLQPHRRPEVVFRCLESTVAGPPPPPPPLTEMAPPPVPSSASPPPPPPTGADLDPDTVSSRYESQLIKTGTMPIGSRRRRAARASPGNDIPFEQLPYQAFQEALKVLAADRVDKLARLRVELAKIARLERREPESVDGGQRTKDRRLAGMRREVERLTIMADVNDPLVKKRFEDGLGDMNKPIYRFLARNKWLAYDHKIITQRIEQFHIVPDLLPKFEPTADVKLFFRSLKVAPGTVVASSVSEKPPRLRVQLFDKGERLFTVVAVDADVPDIKADGFVKRCHFLAANIPLSPCYGSLPFAMVDEKQLAVPWLAPVSQKGAPYHRIAIILLEQRSGESVDVAKLRELYAARDGFSVKSFRDKFLLKPVGFTMFRSLWDEDTADVMARHGLPGADVELRHVHIPSRKTPRKARGWEAKRQGPKYRHLWKYTRRIRGLSTGRGWIKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.56
4 0.56
5 0.54
6 0.49
7 0.55
8 0.56
9 0.55
10 0.49
11 0.46
12 0.46
13 0.45
14 0.43
15 0.34
16 0.26
17 0.22
18 0.23
19 0.2
20 0.18
21 0.2
22 0.24
23 0.26
24 0.25
25 0.23
26 0.25
27 0.28
28 0.31
29 0.33
30 0.33
31 0.35
32 0.38
33 0.37
34 0.33
35 0.3
36 0.28
37 0.24
38 0.27
39 0.29
40 0.33
41 0.36
42 0.39
43 0.43
44 0.44
45 0.44
46 0.4
47 0.37
48 0.35
49 0.33
50 0.31
51 0.29
52 0.28
53 0.27
54 0.25
55 0.22
56 0.18
57 0.17
58 0.15
59 0.15
60 0.14
61 0.19
62 0.19
63 0.2
64 0.27
65 0.28
66 0.27
67 0.26
68 0.29
69 0.25
70 0.26
71 0.24
72 0.24
73 0.34
74 0.37
75 0.41
76 0.46
77 0.51
78 0.55
79 0.61
80 0.63
81 0.63
82 0.69
83 0.68
84 0.66
85 0.64
86 0.6
87 0.53
88 0.45
89 0.37
90 0.28
91 0.26
92 0.2
93 0.18
94 0.17
95 0.18
96 0.18
97 0.16
98 0.15
99 0.12
100 0.14
101 0.12
102 0.12
103 0.1
104 0.09
105 0.08
106 0.11
107 0.11
108 0.1
109 0.1
110 0.13
111 0.13
112 0.14
113 0.16
114 0.19
115 0.19
116 0.2
117 0.23
118 0.24
119 0.26
120 0.28
121 0.28
122 0.26
123 0.27
124 0.27
125 0.27
126 0.27
127 0.28
128 0.29
129 0.33
130 0.32
131 0.32
132 0.32
133 0.32
134 0.31
135 0.32
136 0.29
137 0.25
138 0.25
139 0.28
140 0.29
141 0.29
142 0.32
143 0.29
144 0.32
145 0.41
146 0.46
147 0.49
148 0.54
149 0.54
150 0.52
151 0.54
152 0.48
153 0.4
154 0.32
155 0.25
156 0.17
157 0.15
158 0.12
159 0.1
160 0.1
161 0.09
162 0.08
163 0.09
164 0.08
165 0.09
166 0.13
167 0.13
168 0.13
169 0.15
170 0.17
171 0.17
172 0.19
173 0.2
174 0.24
175 0.26
176 0.26
177 0.24
178 0.23
179 0.22
180 0.2
181 0.18
182 0.12
183 0.12
184 0.14
185 0.2
186 0.28
187 0.3
188 0.34
189 0.35
190 0.35
191 0.35
192 0.37
193 0.36
194 0.32
195 0.3
196 0.31
197 0.34
198 0.32
199 0.31
200 0.32
201 0.31
202 0.27
203 0.29
204 0.24
205 0.21
206 0.22
207 0.21
208 0.16
209 0.11
210 0.13
211 0.11
212 0.11
213 0.1
214 0.09
215 0.09
216 0.09
217 0.11
218 0.1
219 0.15
220 0.14
221 0.16
222 0.16
223 0.17
224 0.18
225 0.16
226 0.15
227 0.12
228 0.12
229 0.15
230 0.15
231 0.14
232 0.13
233 0.14
234 0.14
235 0.11
236 0.11
237 0.07
238 0.07
239 0.08
240 0.09
241 0.1
242 0.12
243 0.13
244 0.15
245 0.22
246 0.25
247 0.29
248 0.29
249 0.31
250 0.37
251 0.45
252 0.46
253 0.41
254 0.41
255 0.36
256 0.35
257 0.31
258 0.24
259 0.15
260 0.12
261 0.1
262 0.08
263 0.07
264 0.07
265 0.07
266 0.05
267 0.06
268 0.06
269 0.05
270 0.04
271 0.04
272 0.04
273 0.05
274 0.06
275 0.09
276 0.12
277 0.16
278 0.18
279 0.2
280 0.2
281 0.2
282 0.2
283 0.18
284 0.23
285 0.27
286 0.26
287 0.25
288 0.25
289 0.24
290 0.24
291 0.23
292 0.15
293 0.1
294 0.09
295 0.09
296 0.1
297 0.11
298 0.1
299 0.1
300 0.11
301 0.09
302 0.1
303 0.1
304 0.1
305 0.09
306 0.09
307 0.09
308 0.08
309 0.08
310 0.08
311 0.07
312 0.08
313 0.09
314 0.09
315 0.13
316 0.15
317 0.18
318 0.2
319 0.23
320 0.26
321 0.29
322 0.31
323 0.28
324 0.26
325 0.24
326 0.23
327 0.23
328 0.25
329 0.22
330 0.2
331 0.18
332 0.17
333 0.18
334 0.17
335 0.12
336 0.08
337 0.08
338 0.11
339 0.13
340 0.14
341 0.14
342 0.14
343 0.14
344 0.17
345 0.16
346 0.16
347 0.22
348 0.22
349 0.22
350 0.22
351 0.23
352 0.2
353 0.23
354 0.22
355 0.16
356 0.25
357 0.26
358 0.27
359 0.31
360 0.32
361 0.33
362 0.41
363 0.5
364 0.4
365 0.41
366 0.41
367 0.42
368 0.41
369 0.38
370 0.34
371 0.26
372 0.27
373 0.29
374 0.28
375 0.23
376 0.24
377 0.23
378 0.17
379 0.18
380 0.17
381 0.13
382 0.12
383 0.1
384 0.11
385 0.1
386 0.1
387 0.09
388 0.09
389 0.08
390 0.09
391 0.11
392 0.12
393 0.11
394 0.14
395 0.16
396 0.18
397 0.19
398 0.18
399 0.21
400 0.24
401 0.3
402 0.36
403 0.45
404 0.52
405 0.6
406 0.7
407 0.75
408 0.79
409 0.83
410 0.84
411 0.84
412 0.83
413 0.85
414 0.84
415 0.84
416 0.83
417 0.81
418 0.81
419 0.76
420 0.78
421 0.78
422 0.78
423 0.78
424 0.77
425 0.8
426 0.8
427 0.85
428 0.86
429 0.86
430 0.82
431 0.76
432 0.73
433 0.73
434 0.71
435 0.69
436 0.63
437 0.62
438 0.63