Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9P3V4

Protein Details
Accession A0A2A9P3V4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKRRLRLAYRKPKWDKAVQIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 5, E.R. 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKRRLRLAYRKPKWDKAVQITQYCFMVVTVIAFILFSEFEFWGEQYKPSRELRNYVFNLFGIMDPDKRYEYSIAVPPRDGSKSESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.75
4 0.77
5 0.73
6 0.7
7 0.63
8 0.57
9 0.49
10 0.4
11 0.31
12 0.2
13 0.14
14 0.08
15 0.06
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.03
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.09
30 0.09
31 0.11
32 0.13
33 0.15
34 0.18
35 0.21
36 0.27
37 0.26
38 0.31
39 0.34
40 0.4
41 0.41
42 0.38
43 0.36
44 0.29
45 0.28
46 0.24
47 0.2
48 0.13
49 0.12
50 0.13
51 0.13
52 0.16
53 0.16
54 0.16
55 0.18
56 0.17
57 0.18
58 0.21
59 0.27
60 0.31
61 0.31
62 0.32
63 0.31
64 0.34
65 0.34
66 0.31