Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P7G8

Protein Details
Accession A0A2A9P7G8   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
73-92LSGRCPARPRRLRPPSPSLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR036898  RNA_pol_Rpb7-like_N_sf  
IPR045113  Rpb7-like  
IPR005576  Rpb7-like_N  
IPR003029  S1_domain  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF00575  S1  
PF03876  SHS2_Rpb7-N  
CDD cd04329  RNAP_II_Rpb7_N  
cd04462  S1_RNAPII_Rpb7  
Amino Acid Sequences MSAANRKRLAPAPTYRDPRLFAPNRLLFQIEIEEKPASASPPLLARHNEAGAPFPRRQPSSSATSSTPRTVSLSGRCPARPRRLRPPSPSLPQSSSLGLLALRCPRGFVPSPSASRARADPIMFFLYNMERRVTLHPSYFGRNMHELVTSKLLKDVEGTCAGSYYIISIMDTFEISEGRILPGNGLAEFTVGYRAVVWRPFKGETVDAVVYSTNPQGFFAQAGPLRLFVSAHLIPSDIKWDPNATPPQFTNNEDTVIEPGTHVRVKIIGTRTEVGEMWAIGSIKEDYLGCLQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.62
4 0.59
5 0.55
6 0.57
7 0.54
8 0.49
9 0.52
10 0.54
11 0.52
12 0.51
13 0.48
14 0.37
15 0.33
16 0.34
17 0.28
18 0.22
19 0.23
20 0.22
21 0.2
22 0.21
23 0.21
24 0.16
25 0.13
26 0.13
27 0.12
28 0.17
29 0.2
30 0.23
31 0.24
32 0.26
33 0.29
34 0.29
35 0.29
36 0.24
37 0.27
38 0.27
39 0.3
40 0.28
41 0.31
42 0.36
43 0.37
44 0.39
45 0.39
46 0.38
47 0.41
48 0.42
49 0.4
50 0.36
51 0.39
52 0.4
53 0.37
54 0.33
55 0.27
56 0.26
57 0.24
58 0.26
59 0.27
60 0.31
61 0.31
62 0.35
63 0.35
64 0.4
65 0.46
66 0.53
67 0.56
68 0.58
69 0.65
70 0.72
71 0.79
72 0.8
73 0.8
74 0.77
75 0.76
76 0.73
77 0.67
78 0.59
79 0.53
80 0.47
81 0.38
82 0.31
83 0.23
84 0.19
85 0.14
86 0.11
87 0.11
88 0.13
89 0.14
90 0.13
91 0.14
92 0.14
93 0.19
94 0.21
95 0.2
96 0.24
97 0.28
98 0.3
99 0.32
100 0.34
101 0.3
102 0.29
103 0.28
104 0.24
105 0.22
106 0.2
107 0.17
108 0.18
109 0.2
110 0.19
111 0.17
112 0.15
113 0.16
114 0.18
115 0.18
116 0.16
117 0.13
118 0.15
119 0.18
120 0.21
121 0.19
122 0.18
123 0.2
124 0.21
125 0.25
126 0.26
127 0.23
128 0.21
129 0.21
130 0.21
131 0.19
132 0.19
133 0.16
134 0.15
135 0.19
136 0.16
137 0.15
138 0.16
139 0.15
140 0.13
141 0.15
142 0.14
143 0.12
144 0.13
145 0.14
146 0.11
147 0.11
148 0.11
149 0.09
150 0.08
151 0.06
152 0.05
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.06
166 0.07
167 0.07
168 0.07
169 0.08
170 0.09
171 0.08
172 0.08
173 0.07
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.09
183 0.14
184 0.16
185 0.16
186 0.2
187 0.21
188 0.22
189 0.23
190 0.23
191 0.19
192 0.22
193 0.21
194 0.17
195 0.17
196 0.15
197 0.13
198 0.13
199 0.13
200 0.1
201 0.09
202 0.11
203 0.11
204 0.11
205 0.12
206 0.11
207 0.14
208 0.14
209 0.16
210 0.16
211 0.16
212 0.16
213 0.15
214 0.14
215 0.1
216 0.15
217 0.14
218 0.14
219 0.14
220 0.14
221 0.14
222 0.14
223 0.19
224 0.13
225 0.13
226 0.14
227 0.16
228 0.17
229 0.25
230 0.33
231 0.3
232 0.33
233 0.34
234 0.39
235 0.4
236 0.41
237 0.4
238 0.32
239 0.33
240 0.29
241 0.29
242 0.24
243 0.22
244 0.19
245 0.13
246 0.13
247 0.16
248 0.17
249 0.16
250 0.15
251 0.16
252 0.18
253 0.24
254 0.28
255 0.27
256 0.31
257 0.33
258 0.33
259 0.33
260 0.32
261 0.26
262 0.23
263 0.18
264 0.14
265 0.15
266 0.14
267 0.11
268 0.13
269 0.12
270 0.11
271 0.13
272 0.12
273 0.12