Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PGG5

Protein Details
Accession A0A2A9PGG5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-118EHKKQKHTYGSWRWRRKKGKSGKDGSPBasic
NLS Segment(s)
PositionSequence
97-114KHTYGSWRWRRKKGKSGK
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MCRLVIFSGACTRCGEEQTWEHLSQQLSCLEAKNNDAFGECERGVYSEQHQFDQECDRCAEEDEGLGDVEDEELIFTSASKRPAESDGTEGEHKKQKHTYGSWRWRRKKGKSGKDGSPTSSAPLSYGMAKASDGEFVDRRVKEGQKEKSESPGRAHLSKALLCVYDTADEALACPRCLPQLSHNGSVSRGMNPGRGHECAAVASFDVGRRPRPAGKHRYERAVDLVLVQVSRARIEQQDEPHEPGKRRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.24
4 0.27
5 0.33
6 0.37
7 0.34
8 0.33
9 0.34
10 0.34
11 0.28
12 0.28
13 0.22
14 0.18
15 0.19
16 0.2
17 0.2
18 0.2
19 0.23
20 0.23
21 0.23
22 0.21
23 0.21
24 0.21
25 0.19
26 0.24
27 0.19
28 0.17
29 0.17
30 0.18
31 0.18
32 0.19
33 0.21
34 0.23
35 0.24
36 0.25
37 0.26
38 0.25
39 0.25
40 0.32
41 0.3
42 0.25
43 0.24
44 0.24
45 0.23
46 0.25
47 0.24
48 0.15
49 0.14
50 0.12
51 0.12
52 0.11
53 0.1
54 0.07
55 0.06
56 0.05
57 0.05
58 0.04
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.07
65 0.1
66 0.13
67 0.14
68 0.14
69 0.16
70 0.19
71 0.22
72 0.2
73 0.2
74 0.19
75 0.22
76 0.24
77 0.23
78 0.25
79 0.27
80 0.26
81 0.28
82 0.31
83 0.32
84 0.37
85 0.41
86 0.47
87 0.52
88 0.62
89 0.69
90 0.75
91 0.78
92 0.81
93 0.86
94 0.84
95 0.83
96 0.83
97 0.83
98 0.82
99 0.81
100 0.78
101 0.76
102 0.7
103 0.62
104 0.55
105 0.45
106 0.36
107 0.3
108 0.22
109 0.14
110 0.14
111 0.11
112 0.08
113 0.09
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.07
120 0.06
121 0.08
122 0.08
123 0.11
124 0.17
125 0.16
126 0.18
127 0.21
128 0.23
129 0.28
130 0.36
131 0.42
132 0.43
133 0.48
134 0.46
135 0.52
136 0.54
137 0.5
138 0.44
139 0.44
140 0.4
141 0.37
142 0.37
143 0.31
144 0.29
145 0.28
146 0.26
147 0.19
148 0.16
149 0.15
150 0.15
151 0.13
152 0.1
153 0.1
154 0.09
155 0.08
156 0.07
157 0.08
158 0.11
159 0.11
160 0.1
161 0.11
162 0.11
163 0.12
164 0.14
165 0.16
166 0.17
167 0.27
168 0.32
169 0.36
170 0.38
171 0.37
172 0.36
173 0.37
174 0.33
175 0.24
176 0.22
177 0.19
178 0.22
179 0.22
180 0.26
181 0.26
182 0.27
183 0.27
184 0.24
185 0.24
186 0.19
187 0.2
188 0.15
189 0.11
190 0.1
191 0.1
192 0.1
193 0.14
194 0.16
195 0.18
196 0.21
197 0.25
198 0.31
199 0.39
200 0.48
201 0.54
202 0.62
203 0.7
204 0.72
205 0.76
206 0.73
207 0.67
208 0.61
209 0.54
210 0.44
211 0.34
212 0.31
213 0.23
214 0.2
215 0.17
216 0.15
217 0.13
218 0.14
219 0.14
220 0.14
221 0.16
222 0.22
223 0.28
224 0.33
225 0.41
226 0.43
227 0.48
228 0.51
229 0.55
230 0.53