Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PEQ5

Protein Details
Accession A0A2A9PEQ5    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-127DDLKSQRKQIRKLKKCEETRQQIRNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9cyto_nucl 9, mito 8, nucl 5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021054  Cell_wall_mannoprotein_1  
Pfam View protein in Pfam  
PF12296  HsbA  
Amino Acid Sequences MKCSLQLLIAALATASPLIFERDLASVTKVVQSVGSKIDALDTVIRNFAGDTAGVVTASEALVSTVMSGISEVEKSEELPLNDAVKLIGPVADLEKHGQKLRDDLKSQRKQIRKLKKCEETRQQIRNISFAAQQLTKALTSKVPARARPIAESKAKGFLDILATAKKDFDEDDCSDTKPDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.04
4 0.05
5 0.08
6 0.08
7 0.09
8 0.1
9 0.11
10 0.13
11 0.13
12 0.14
13 0.12
14 0.13
15 0.15
16 0.14
17 0.13
18 0.15
19 0.15
20 0.15
21 0.16
22 0.16
23 0.14
24 0.13
25 0.14
26 0.12
27 0.12
28 0.14
29 0.14
30 0.13
31 0.14
32 0.14
33 0.13
34 0.13
35 0.12
36 0.08
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.08
64 0.11
65 0.1
66 0.12
67 0.13
68 0.13
69 0.13
70 0.12
71 0.1
72 0.08
73 0.08
74 0.06
75 0.05
76 0.04
77 0.04
78 0.05
79 0.05
80 0.06
81 0.07
82 0.09
83 0.11
84 0.13
85 0.15
86 0.14
87 0.2
88 0.25
89 0.29
90 0.3
91 0.37
92 0.46
93 0.51
94 0.58
95 0.6
96 0.61
97 0.65
98 0.72
99 0.75
100 0.74
101 0.76
102 0.79
103 0.8
104 0.82
105 0.83
106 0.83
107 0.82
108 0.82
109 0.79
110 0.75
111 0.72
112 0.64
113 0.56
114 0.47
115 0.38
116 0.31
117 0.26
118 0.24
119 0.18
120 0.17
121 0.16
122 0.16
123 0.15
124 0.14
125 0.13
126 0.11
127 0.14
128 0.19
129 0.27
130 0.32
131 0.34
132 0.4
133 0.45
134 0.46
135 0.49
136 0.49
137 0.47
138 0.48
139 0.48
140 0.44
141 0.45
142 0.43
143 0.38
144 0.32
145 0.27
146 0.24
147 0.22
148 0.22
149 0.18
150 0.19
151 0.19
152 0.19
153 0.17
154 0.15
155 0.14
156 0.15
157 0.19
158 0.21
159 0.26
160 0.27
161 0.28
162 0.28